SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000128600 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000128600
Domain Number 1 Region: 18-444
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 7.53e-90
Family L-arabinose binding protein-like 0.0022
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000128600
Domain Number - Region: 453-489
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0051
Family TNF receptor-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000128600   Gene: ENSMUSG00000090773   Transcript: ENSMUST00000172368
Sequence length 492
Comment pep:known chromosome:NCBIM37:7:92452571:92459002:1 gene:ENSMUSG00000090773 transcript:ENSMUST00000172368
Sequence
NDLGDKETYCFFSIYTKHGYVKNDYFGWNLDKQVTPKTNHLIFSVYLAMEEINKNDHILP
NISLLVNIECGLELYGERTDLALKSKELIPNYYCRNHRRYLIVLTTPKWGVSTSIGQLLY
ISRIPEISPKDTSLPLAMVSLVVHFRWNWIGAIVTNDDHGIQFLSELRGEMQKHVVCLSV
AIIIQTQKFMALKDYRMNYNKIAMSSAKVVIVYGDKDSPIQFTLIMWKSEGIRRIWVSVS
QFDMITIIGEFLLYSSMGSFIFSHQQPEISDFEQFIKTVHPSNYSSEFSLAKLWWMYFRC
SLPPSNCKKLKNCPIITVFKWLFMTPFGMAMSDTCYNLYNAMYAVAHSLHEMLLQQVDTW
SNNAGKELEFDSWKMFSILKTLQFVNPAGDLVNMNQNLKQDTVYDIFYILNFQKYFGLKI
KIGIFSGYLPSGQQLYMSKEMMEWATDMDQILPSICSRPCTPGLRKSPQEGNDICCFICK
PCPENEISNMTS
Download sequence
Identical sequences ENSMUSP00000128600

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]