SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000128792 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000128792
Domain Number 1 Region: 55-500
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 7.06e-102
Family L-arabinose binding protein-like 0.0049
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000128792
Domain Number - Region: 506-556
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00424
Family TNF receptor-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000128792   Gene: ENSMUSG00000092048   Transcript: ENSMUST00000171811
Sequence length 850
Comment pep:known chromosome:NCBIM37:10:129855317:129866668:-1 gene:ENSMUSG00000092048 transcript:ENSMUST00000171811
Sequence
MKKMCSLTMSFLFLKFSLILCCLTEPICFWRIKSSEYNDENLQSECGYFLWTMKKLMKDD
FYNVRLDFRMPAREYEFVLVMFFATDEINKNPDLLPNTSLVFSVMADKCQDSLGILDLKY
MLVNDTLNYVNYVCEADDSCAIGLTGPSWKASLKLAIDTWAPKVFFGPFNPNLSDHDRFP
NVHQIATKDTHLSHGMVSLMLHFRWTWIGLVISDDDQGVQLHSDLREESQRHGICLAFVN
VIPETMKIYMTRGNMYDKQIMTSSAKVVIIYGEMNSTLEISFRRWVYLGAQRIWITTSQW
DVITNKKDFSLDLFHGTVTFAHHKGWIAKFKNFMQTMNTSKYPISISESILRWNYLNCSV
SKNSIKMDHFTCKNPLELTALHNYDMALSDEGYNLYNAVYAVAHTYHEHILQQVESQKMV
EDKGKYTECQQLAPLLKTRVFTNPVGELVDMNHREYQCAEYDIFIIWNFPQGLGLKVKIG
SYFPCFPQSQQLHISEDLEWATGGTSVPSSMCSVTCTAGFRKIHQKETADCCFDCVQCPE
NEVSNETADMEQCVRCPDDKYANIEQTHCLQRAVSFLAYEDPLGMALGCMALSFTAITIL
VLVTFVKYKDTPIVKANNCILSYILLISLVFCFLCSLLFIGHPNQVTCILQQTTFGLFFT
VAVSTVLAKTITVVMAFKLTTPGRRMRGMMMMTGAPKLVIPICTLIQLVLCGIWLLTSPP
FIERDIQSEHGKTVIFCNTGSVLSFHVVLGYLGSLALGSFTVAFLARNLPDRFNEAKFLT
FSMLVFCSVWITFLPVYHSTRGKVMVVVEVFSILASSAGLLGCIFVPKCYVILVRPDSHF
IQKYKGKLHY
Download sequence
Identical sequences G3UW56
ENSMUSP00000128792 NP_001096072.1.92730 ENSMUSP00000128792 ENSMUSP00000128792

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]