SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000128981 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000128981
Domain Number 1 Region: 31-509
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 4.71e-91
Family L-arabinose binding protein-like 0.00073
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000128981
Domain Number - Region: 520-580
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0135
Family Growth factor receptor domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000128981   Gene: ENSMUSG00000090960   Transcript: ENSMUST00000163607
Sequence length 853
Comment pep:known chromosome:NCBIM37:6:123442526:123483424:-1 gene:ENSMUSG00000090960 transcript:ENSMUST00000163607
Sequence
MKLLIAFSLWIVLIVLQEQISCYLLSISASPGYYQDGDFVIGGLLSLKVSGRHNKNKFTS
GNEYNLPEYVYIDFTKHYQHILAMVFAIEKINKDPNILFNMSLGFHVFNVDFTEMKAMKS
SMVLLSGESPPVPNYSCRPEKTDKLVAVIGGISTGISTQISRVLSLYNVPQISYAPFDQS
LGTIVQLQSPYQFPVHTAALYQGIIQLLLYFTWVWVGLVVPDDIRGELFLRDITEEMMNH
GLCVAFAEKIQGILAEDKVNTKLFNEKFTLTRVIIAFGDTYSLLALAVHTTFYTTFRNVW
ITTSDWDITFYFQQPKSYEYFGGGLSFTDRMDQILGFKDFLRNVQPRKYPQDIFIQDVWM
VLFECPYLIDHEARQLSQCEPNGSLSTRPLHVWDMNTSPCSSKVHAAVYAIAQALHEELS
LRVEGGSLDKSVLRAPLPWKLHPFLQKGQLGRSSNKENIVNKEILATEFDIFNYQSLQSG
TKAQVKVGEFVFESHRVQHFSINEKLITWGKYGKGIPLSVCSQSCPLGFRKTPVEGKSFC
CFDCLPCPEGEVANDTDMDQCIKCPEDQYPNKQKNNCLPKIKIFLSHEDTLGAVLVSLAI
SLSAFSAMILGLFIHYRDTPIVRANNRNLSYVLLVSLMLCFFCSLIFIGQPSTVTCVLRQ
MIFGVVFSVAVSAILAKTFIVVVAFTAIKPGSTLQMWMVTRLSNAIVCCGSIIQVCICAV
WLGTYPPFPDADMHSEFGQIILWCNEGSTLAFYCVLGYLGFLSSLSLLIAFLARRLPESF
NEAKTITFSMLVFCTVWITFVPTYLSSKGKTMVAVEILSILASSSILLLCIFLPKCYVIL
LRSGGHSRKKFFK
Download sequence
Identical sequences K7N6Y7
ENSMUSP00000128981 ENSMUSP00000128981 ENSMUSP00000128981 NP_001098105.1.92730 PGOMOU00000137311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]