SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000129089 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000129089
Domain Number 1 Region: 33-507
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 7.74e-123
Family L-arabinose binding protein-like 0.00015
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000129089
Domain Number - Region: 512-576,635-653
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00298
Family Growth factor receptor domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000129089   Gene: ENSMUSG00000090751   Transcript: ENSMUST00000163803
Sequence length 859
Comment pep:known chromosome:NCBIM37:7:50158621:50189159:-1 gene:ENSMUSG00000090751 transcript:ENSMUST00000163803
Sequence
MFWIFIFGVLYIPNFVCAFTGDKCYGKIKEYTYQEGDVTIGAFFPLHSYYTHDHVSHEIE
LYYFQDMYLKYNFMNYQFLLALVFTIEEINRNPHLLPNTTLGFEHHNIKFSEKNILLGPF
LWLAGLSNQLVNYNCGQKRNLPAALTGTSWAISAHIGTLLQLYKIPQLTFAYFDSNMNDQ
SQFKTLYQVAPEDTYLSLALVSLMLHFSWSWVGLIVPNDPRGTQILSEFRDVMESNRICL
AFVKMIPGTWNSYSDAIWKNMEKIQESSANVIVICGDIVSLQGLMRHIAQLLVTWKVWVL
NSQWDIDYYSDYFMIESFHGSLIFSHHHEEMVEFVNFVQTVNPYTYPEDAYLPKFWVIFF
NCSFSEFDCQLLENCQPNASLDLLPRHIFDPTMSEESYNIYNAVHALAHSLHEMTVQQIQ
TQPYANGDGMAFLPWQILPFLKITLLENHLSSRSVIDERKNLYSEYDIFNFWNFPTGLGL
KMKVGTFSPNSPQGQQLSLSEEMIQWPTQFTKIPQSLCSESCRPGFRKAAQEGKAVCCFD
CIPCADNEISNETDMDQCVQCPESHYANSEKNHCLQKSVSFLAYEEPLGMALTITALDFS
VLTAVVLVVFVKHRDTPIVKANNRVLSYTLLLTLIICFLSCLLYIGQPNTATCILQQTAF
GTLFTVALSTVLAKAIVVVTAFKVTSPARMVKWLIVIGAPNLIIPICTLIQLIICGIWLA
TSPPFIDQNAHVEHGHIIIMCNKGSAVAFHCVLGYLCSLALGSYTMAFLSRNLPDTFNEA
KCLSFSMQVFFCVWITFLPVYHSTKGKVMVAMEVLSVLASSITLLVLIFAPKCYIILLRP
DKNSCLDIRHKIHSRKVVI
Download sequence
Identical sequences E9Q0K5
NP_001098530.1.92730 ENSMUSP00000129089 ENSMUSP00000129089 ENSMUSP00000129089

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]