SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000129215 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000129215
Domain Number 1 Region: 54-500
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.69e-106
Family L-arabinose binding protein-like 0.0038
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000129215
Domain Number - Region: 504-556
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00073
Family TNF receptor-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000129215   Gene: ENSMUSG00000091511   Transcript: ENSMUST00000164227
Sequence length 848
Comment pep:known chromosome:NCBIM37:10:129908877:129934435:-1 gene:ENSMUSG00000091511 transcript:ENSMUST00000164227
Sequence
MKKMCVLTTSFLFLKFSLILCCLTEPICFWRIKDSEYNDGELQSECGFFLWTMEKPMEDD
FYNVRFDFRIPASEYEFVLVMFFATDEINKNPDLLPNTSLVFSVIGGKCQDSLGLLGEEY
ILINDSLNYVNYVCKADDTCVIDLTGPSWKTSLKLAIDSWTPKVFFGPFNPNLSDHDRFP
YVHQVATKDTHLSHGMVSLMLHFRWTWIGLVISDDDQGIQLHSDLREESQRHGICLAFVN
VIPETMKIYMTRGNMYDKQIMTSSAKVVIIYGEMNSTLEISFRRWVYLGARRIWITTSQW
DVITNKKDFSLDLFHGTVTFAHHKGWIAKFKNFMQTMNTSKYPINISQSVLRWNYFNCSV
SKNSIKMDHFTCKNPLEWTALHNYDMALSDEGYNLYNAVYAVAHAYHEHILHQVESQKMA
EDKGKYTECQQLAPLLKTRVFTNPVGELVNMNQREYQCAEYDIFIIWNFPQGLGLKVKIG
NYFPCFPRSQQLHISEDLEWVTGGTLVPSSMCSVTCTPGFRKIHQKETADCCFDCVQCPE
NEVSNETADMEQCVRCPDDKYANLEQSHCLQRTVSFLAYEDPLGMVLGSMALSSSAITIL
VLVTFMKYKDTPIVKANNCILSYILLISLVFCFLCSLLFIEHPNQVTCILQQTTFGLFFT
VAVSTVLAKTITVVMAFKLTTPGKRMRGMMTGAPKLVIPICTLIQLVLCGIWLLTSPPFI
DRDIQSEHGKTVIFCNKGSVIAFHVVLGYLGSLALGSFTVAFLARNLPDRFNEAKFLTFS
MLVFCSVWITFLPVYHSTRGKIMVVVEVFSILASSAGLLGCIFVPKCYVILVRPDSNFIQ
KYKGKLLY
Download sequence
Identical sequences E9PZX4
ENSMUSP00000129215 ENSMUSP00000129215 ENSMUSP00000129215 NP_001096836.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]