SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000129313 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000129313
Domain Number 1 Region: 35-506
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.24e-111
Family L-arabinose binding protein-like 0.00016
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000129313
Domain Number - Region: 514-561
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0129
Family TNF receptor-like 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000129313   Gene: ENSMUSG00000091491   Transcript: ENSMUST00000168710
Sequence length 861
Comment pep:known chromosome:NCBIM37:17:19051286:19085035:1 gene:ENSMUSG00000091491 transcript:ENSMUST00000168710
Sequence
MFSRIFIFRLLQISNFFSAFSYNISTCYYKISEEFHREGDVVIGAFFPLHTFYSLKKMQH
STIPYYYLDNVIQYNFKNYQYILALQFAIEEINGNPNLLPNISLGFDFYNVRFTGKYIHS
NTFNWLTALGDGNYIPNYNCKKRNFTAALTGTSWITSAQIGTLLQLFKFPQISFGPYDLL
LSDRGQYPYLYQMAPKDTSLPLAIVSLIVHFRWSWVGLILPDDHKGNKILSDFREEMERN
GICLAFVKMTSETWTSYVAKFWENMHETNVTIIYGENDSLEGIIRNIEQRLLTWNVWIMN
IEHHVIDRADYFMLDSFHGSLIFKHNYRENFEFTKFIQTVNPNKYPEDIYLPKLWYLFFK
CSFSDTNCHVLENCQTNASLDVFPRHIFDVAMNAESTIIYNGVYAVAHSLHEMRLQQLQM
QTYENHHGIVLFPWQVITFLLYFIVSTLVKDKRSLDWRQIRDTEYDILNIWNLPKGLGLK
VKIGSFSANAPQGQQLSLSEQMIQWPTIFSEIPQSVCSESCGPGFRKVTLEGKAICCYKC
TPCADNEISNETDVDKCVKCQERHYANREKSNCFQKSVSFLAYEDPLGMVLASIAICLSA
LTVFVIGIFMKHRDTPIVKANNRALSYILLITLTFCFLCSLNFIGKPTTASCILQQTTFA
VAFTMALATVLAKAITVVLAFKVSFPGRMVRWLMISRGPNYIIPICTLIQLLICGIWMAT
SPPFIDQDAHTEYGHIIILCNKGSAVAFHSVLGYLCLMALGSYAMAFLSRNLPDTFNESK
FLSFSMLVFFCVWVTFLPVYHSTKGKVMVAMEVFSILASSTALLIFIFGPKCYIILLRPD
KNSFNHIRKKTPTRKKNFPKI
Download sequence
Identical sequences K7N6Z2
ENSMUSP00000129313 ENSMUSP00000129313 NP_001098019.1.92730 ENSMUSP00000129313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]