SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000129411 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000129411
Domain Number 1 Region: 46-498
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 6.28e-98
Family L-arabinose binding protein-like 0.001
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000129411
Domain Number - Region: 507-554
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0306
Family TNF receptor-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000129411   Gene: ENSMUSG00000066432   Transcript: ENSMUST00000061074
Sequence length 851
Comment pep:known chromosome:NCBIM37:7:92370028:92386214:-1 gene:ENSMUSG00000066432 transcript:ENSMUST00000061074
Sequence
MFSLISVIWFLKVKLMFCHLSDPKCFWRIKDTENNLGDTETYCSFSISTRHGYVKNDYFS
WNLDKKVTPKTNHLIFSVYLALDEINMNIHILPNISMVANIECFLQKDGEKTGLALQRKE
FIPNYYCTDERRYLIIFTAPIWAVTTRLGPLMFMYSIPELYCGHFHLSLNDNEQFPHLYQ
ISPKDTSLPLAMVSLMVHFRWNWIGAMITNDDHGIQFLSKLRGEMQKHIVCLSFVITILT
EHSMAHKEFQRYFNRIVMSSAKVVIVYGDYTSPIDLVLHLCKSKGIFRIWVSVSQFDMIT
YLGDFMLYSSSGTFIFSHQKPELSGFQQFIQTVHPSNYSSEFSFAKLWWTYFRCSLPPFN
CKKLKNCPTKIVFKWLFMTPLGMAMSDTCYNLYNAIHAVAHSLHEMLLQQVDTWSNNAGK
ELEFDTWKMFSILKTLQFVNPAGDLVNMNQNLKQDTEYEIFYIMDFQKDYGLKMKIGRFS
GHLPSRQQLYMSKEMMEWAIDVDQILPSICSMPCRPGLRKSPQEEKDICCFVCNPCLENE
ISNMTNMDQCVKCREDQYANEHHTLCLQKVVSILDYRDPLGKALAGIALCFSFLTSVVLC
IFLKHRETPIVKANNQTLSYVLLISLVFCFICSLLYIGHPTAVICILQQTTFVIAFTVAT
STILAKTITVLLAFKITIPGRRMRWLLVSGAPKYIILICTMIQLILCGIWLGTSPPFVDA
DAHMVHGHIIIVCNKGSVIAFYCVLGYMGSVALASFTVAFLARNLPDTFNEAKLLTFSML
VFCSVWITFIPVYHSTKGKTMVAVEVFCILASSAGLLLCIFAPKCYIILLRPDINSFQKF
RKPHANAENIS
Download sequence
Identical sequences L7N2B3
ENSMUSP00000129411 ENSMUSP00000129411 ENSMUSP00000129411 NP_001098651.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]