SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000129466 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000129466
Domain Number 1 Region: 52-487
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 6.28e-96
Family L-arabinose binding protein-like 0.0039
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000129466
Domain Number - Region: 512-559
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00953
Family TNF receptor-like 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000129466   Gene: ENSMUSG00000090662   Transcript: ENSMUST00000164845
Sequence length 852
Comment pep:known chromosome:NCBIM37:7:9638311:9655801:1 gene:ENSMUSG00000090662 transcript:ENSMUST00000164845
Sequence
MFIFMEVFFLLNITLLMANFIDPRCFWRINLDEIMDEYLGLSCAFILAAVQTPIENDYFN
KTLNVLKTTKNHKYALALVFAMDEINRNPDLLPNMSLIIRYSLGHCDGKTVIPTPYLFRK
KKESPIPNYFCNEETMCSYLLTGPHWEVSLGFWKHVNSFLSPRILQLTYGPFHSIFSDDE
QYPYLYQMAPKDTSLALAMVSFILYFSWNWIGLVIPDDDQGNQFLLELKKQSENKEICFA
FVKMISVDDVSFPQNIEMYYNQIVMSSTNVIIIYGETYNFIDLIFRMWEPPILQRIWITT
KQLNFPTRKTDISHGTFYGSLTFLPHHGVISGFKNFVQTWFHLRNTDLYLVMQEWKYFNY
EDSASTCKIKKNNSSNASFDWLMEQKFDMTFSENSHNIYNAVHAIAHALHEMNLQQADNQ
AIDNGKGASSHCLKVNSFLRRIYFTNPPGDKVFMKQRVIMQDEYDIVHFVNLSQHLGIKM
KLGKFSPYLPHGRHSHLYVDMIELATGRRKMPSSVCSADCSPGFRRLWKEGMAACCFVCS
PCPENEISNETNMDQCMNCPEYQYANTEQNKCIQKGVTFLSYEDPLGMALALMAFCFSAF
TAVVLCVFVKHHDTPIVKANNRSLSYLLLMSLMFCFLCSFFFIGLPNRAICVLQQITFGI
VFTVALSTVLAKTVTVVLAFKVTDPGRRLRNFLVSGTPNYIIPICSLLQCVLCAIWLAVS
PPFVDIDEHTLHGHIIIVCNKGSVTAFYCILGYLACLALGSFSVAFLAKNLPDAFNEAKF
LTFSMLVFCSVWVTFLPVYHSTKGKHMVAVEIFSILASSAGILGCIFVPKIYIILTRPER
NSTQKIREKSYF
Download sequence
Identical sequences L7N2B5
NP_001098545.1.92730 ENSMUSP00000129466 ENSMUSP00000129466 ENSMUSP00000129466

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]