SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000129540 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000129540
Domain Number 1 Region: 67-501
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 5.49e-103
Family L-arabinose binding protein-like 0.003
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000129540
Domain Number - Region: 510-556
Classification Level Classification E-value
Superfamily TNF receptor-like 0.011
Family TNF receptor-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000129540   Gene: ENSMUSG00000090949   Transcript: ENSMUST00000164996
Sequence length 854
Comment pep:known chromosome:NCBIM37:7:93943651:93960542:1 gene:ENSMUSG00000090949 transcript:ENSMUST00000164996
Sequence
MAEMFSLIVFFLVLKLSFLFCYLSDPRCFWRIKDRENYLGDKEADCFFSIYTKRGYVKND
YFSENLDKKVTLKTIYLISSVYFAIEEINRNIHILPNISLLVKIDCNLIEDNVERVWSLK
KKEIIPNYYCKNQRRYLIVLTGPIWITSYILGPFLYFSRTPELYCGYFHLLLSDQEQFPH
LYQMTPKDTSLPLAMVSLAVHFRWNWVGVIITDDDHGIQFLSELRTGMERNTVCLAFVTS
ITYDKMLYLKMTHKYYHQIIMSSAKVVVVYGDKESPLQLNFMLWKSINIQRLWVSVSQFD
MITMMGDFMLNSIHGTLIFSHQQSEMSGFKHFIQRVNPSNYSNDISLAKLWWTYFKCSLP
PPDCKTLKNCPTKTLFQWFFEPPLGMSMSETCYNLYNSVYAAAHSIHEMLLQHVDTSSEN
DENVLEFNSWKMFSFVKNIQFVNPAGDLVNMNQNRKLDTEYDIFYITDFLKHEGLKMKIG
RFSGHFPNGQQLFISDEMIEWATDIKQTLASICSVPCRPGLRKYFQEGNSVCCFDCYPCP
ENEISNMTDMDQCVKCPEDEYANTNQTKCFKKVVTFLAYEDPSGMALAVLAVCFSVLTSV
VLCVFLKHRNTPIVKANNETLSYVLLTSLIFCFICSLLYIGYPTMVSCILQQTTFAIVFT
VAASCVLAKTITVVLAFKITVPGRRLRWLLLSGAPNYIIPICTMIQMILCGIWLGTSPPF
VDADLHMVHGHIIIVCNKGSVIAFYCVLGYMGSLALSSFTVAFLARNLPDTFNEAKLLTF
SMLVFCSVWITFLPVYHSTKGKAMVAVEVFCILASSAGMLVCIFLPKCYIILLRPQINSF
HDFRKIHVKVININ
Download sequence
Identical sequences L7N2B7
ENSMUSP00000129540 NP_001098658.1.92730 ENSMUSP00000129540 ENSMUSP00000129540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]