SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000129578 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000129578
Domain Number 1 Region: 47-490
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 3.36e-100
Family L-arabinose binding protein-like 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000129578
Domain Number - Region: 607-815
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.00235
Family Calcium ATPase, transmembrane domain M 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000129578   Gene: ENSMUSG00000090366   Transcript: ENSMUST00000167957
Sequence length 861
Comment pep:known chromosome:NCBIM37:7:8788645:9001004:1 gene:ENSMUSG00000090366 transcript:ENSMUST00000167957
Sequence
MFTLMGVFFLLNIPLFMANFIDPRCFWRINLNEIQDEYLGLTCAFILAVVQKPIEKDYFN
KTLNFLKTTKNHKYALALAFAMDEINRNSDLLPNMSLIIRYTLGRCDGKTVIPTPYLFHK
KKQSPIPNYFCNEETMCSFLLTGPNWGVSISFWKYLDSFLSPRILQLTYGPFSSIFSDDE
QYPYLYQMAPKDTSLALAMVSFILYFNWNWIGLVIPDDDQGNQFLLELKKQKENKEICFA
FVKMISVDDISFEHKTEMYYKQIVMSSSNVIIIYEETIDFVDLIFRMWEPPGLQRIWITT
KQWNFPTSKRDITHGIIYGSLTFLPHHGGISGFKDFVQTWFHLRSKDLYLVMPEWKYFKY
ESSASKCKILKNNSSDASFDWLMEQKFDMAFSESSHNIYNAVHAIAHALHEMNLQQVDNQ
AIDNGKGASSHCLKVNSFLRKIHFTNPLGDKVIMKQRVIMQEEYDIFHFGNLSQHLGIKV
KLGKFSPYFSHGRNFHLYVDMLEVATGSRKMPSSVCSAEYSPGFRRLWKDGMAACCFVCS
PCPENEISNETNMDQCVNCPEYQYANTEQNKCIQKGVTFLSYEDPLGMALALMAFCFSAF
TAVVLCVFVKHHDTPIVKANNRILSYILLISLMSCFLCSFFFIGHPNRATCVLQQITFGI
VFTVAVSKVLAKTVTVVLAFKVTDPGRRLRNFLVSGTPNYIIPICSLLQCVLCAIWLAVS
PPFVDIDEHTLHGHIIIVCNKGSVTAFYCVLEYLACLALGSFTLAFLAKNLPDTFNEAKF
LTFSMLVFFSVWVTFLSVYHSTKGKVMVAVEIFSILASSAGMLGCIFAPKNCIILMRPER
NSTQKIKERNSTQKIKEKSYF
Download sequence
Identical sequences ENSMUSP00000129578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]