SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000129762 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000129762
Domain Number 1 Region: 36-505
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 4.04e-118
Family L-arabinose binding protein-like 0.00027
Further Details:      
 
Domain Number 2 Region: 514-572,635-652
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000581
Family Growth factor receptor domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000129762   Gene: ENSMUSG00000091670   Transcript: ENSMUST00000167382
Sequence length 860
Comment pep:known chromosome:NCBIM37:17:20345194:20371836:-1 gene:ENSMUSG00000091670 transcript:ENSMUST00000167382
Sequence
MFSWIFIPLFLQIPNFFCVFISYNISKCYYIIAEDFHHKGDVVIGAFFPIHTYHTMNKSC
DIKAIFLLLILCHLHRYNFKSYQYILALLFAIEEINGNPNLLPNISLGFDFYNVRFTEKD
TLMNVCMWLTAHREKFILPNYNCEKKYFTAALTGTSWTISAQIGTLFQLFKFPQLSFGPY
DPILSDRNQYSFLYQIAPKSSSLSLGIVSLMVHFRWSWVGLILPDDHKGNKILSDFKNEM
ERKGICIAFVKMIPATWSSHLNQFWKNIDETNVIIIYGDIDSLEGLMRNIRQRLLTGKVW
VMNIEPHFTDYADYFFLDSFHGSLIFTYHYSERFEFTNFIQTVNPYKYPEDIYLPKLWHL
FFKCSFSDNGCQLLNNCQFNASLDALPRHIFDESMSDESTSIYNAVYAVAHSLHELTLQQ
VQMEPYENGEETLFFPWQLNSFLKDIEVGGQMRLDWRQEVNVKYDILNIWNLPKGLGRKV
KIGSFSPNAPQGQQLSLTEQIIQWPEEFSEIPRSVCSESCGHGFRKVILEGNAVCCYKCT
PCAHNEISNKTDEDQCMKCPDSHYANTEKNYCLKKAVSFLAYEDLLGMILASIALCLSAL
TVFVIGIFVKNRHTPIVKANNQALSYILLITLTFCFLCSLTFIGQPNKNTCILQQTTFGV
AFTAALATVLAKAITVVIAFKATFPGRIVRWLMISRAPNYIIPICTLIQVGFCGTWMATS
PPFIDQDAHTEHGHIIIFCNKGSSVAFHCVLGYLCFLALCGYTVAFLSRTLPDTFNESKF
LSFSLLVFFCVWVTFLPVYHSTKGKFMVATEIFSILASSTALLGFIFGPKCYIVLLRPDE
NTFNYIRNKIHSRKNKSQKT
Download sequence
Identical sequences E9Q3A5
ENSMUSP00000129762 ENSMUSP00000129762 NP_001098037.1.92730 ENSMUSP00000129762

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]