SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000130160 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000130160
Domain Number 1 Region: 51-487
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 4.37e-93
Family L-arabinose binding protein-like 0.0043
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000130160
Domain Number - Region: 512-559
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0118
Family TNF receptor-like 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000130160   Gene: ENSMUSG00000091545   Transcript: ENSMUST00000170131
Sequence length 852
Comment pep:known chromosome:NCBIM37:7:10402131:10426674:-1 gene:ENSMUSG00000091545 transcript:ENSMUST00000170131
Sequence
MFIFMGVFFLLNITLLMANFIDPRCFWRINLDEITDEYLGLSCTFILAAVQTPTEKDYFN
KTLNVLKTTKNHKYALALVFAMDEINRNPDLLPNMSLIIRYTLGLCDGKTVTPTPYLFHK
KKQSPIPNYFCNEETMCSFQLSGPKWDVSLSFWMYLDSFLSLRILQLTYGPFYSIFSDDE
QYPYLYQMAPKDTSLALAMVSFILYLKWNWIGLVIPDDDQGNQFLLELKKQSENKEICFA
FVKMISVDDTSFPHKTEMDYNQIVMSSTNVIIIYGETRNFIYLIFRMWEPPILQRIWITT
KQLNFPTRKTDISHGTFYGSLTFLPHHGEISGFKKFVQTWFHVRNTDLYLVMPEWNYFNY
VSSASNCKILKNNSSDASFDWLMEQKFDMTFSENSHNIYNAVHAIAHALHEMNLQQADNQ
AIGNGKGASSHCLKVNSFLRRTCFTNPLGDKVFMKQRVIMQDEYDIIHFGNLSQHLGIKM
KLGKFSPYLPHGRHSHLYVDMIELATGRRKMPSSVCSADCSPGFRRLWKEGMAACCFVCS
PCPENEISNETNMDQCVNCPEYQYANTEQNKCIQKGVTFLSYEDPLGMALALMAFCFSAF
TAVVLCVFVKHHDTPIVKANNRSLSYLLLMSLMFCFLCSFFFIGLPNRAICVLQQITFGI
VFTVAVSTVLAKTVTVVLAFKVTDPGRRLRNFLVSGTPNYIIPICSLLQCVLCAIWLAVS
PPFVDIDEHTLHGHIIIVCNKGSDTAFYCILGYLACMALGSFSLAFLAKNLPDTFNEAKF
LTFSMLVFCSVWVTFLPVYHSTKGKHMVAVEIFSILASSAGILGCIFVPKIYIIFMRPER
NSTQKIREKSYF
Download sequence
Identical sequences K7N709
NP_001098621.1.92730 XP_001479019.1.92730 ENSMUSP00000130160 ENSMUSP00000130160 ENSMUSP00000134157 ENSMUSP00000130160 ENSMUSP00000134157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]