SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000130373 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000130373
Domain Number 1 Region: 36-502
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.75e-111
Family L-arabinose binding protein-like 0.00022
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000130373
Domain Number - Region: 503-570,633-650
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00691
Family Growth factor receptor domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000130373   Gene: ENSMUSG00000091805   Transcript: ENSMUST00000167314
Sequence length 855
Comment pep:known chromosome:NCBIM37:17:20599337:20618200:-1 gene:ENSMUSG00000091805 transcript:ENSMUST00000167314
Sequence
MFSCIFISSLLLIAKFVLTFMHVNISKCFYKITEDFHHEGDVVIGAFFPLHTYYTKNKIP
HSYLPYYYKDNYLQYNFKNYQYILALVFAIEEINDNPNLLPNISLGFDFYNVRFIEKDTL
MNVCFWLTGQGQKNILPNYNCGKSNFATALTGTAWTTSAQIGTLLQLFKFPQLSFGPYDS
ILSDRGQYSSLYQMASKYTSISLGIVSLMVHFRWSWVGLILPDNHKGNKILSEFREDMER
KGVCIAFVKMIPMTWNAYYNKFWENMDETNVIIIYGDIDSLTGLMRNIGQRLLTAKVWIM
NTEPHITDYADYFMLDSFHGSLIFTHNYRKSFKISNFIQTVNPYKYPEDIYLPKLWHLFF
KCSFSDVDCRLLANCQPNASLDVLPSHILDMVISEESNNIYNAVYAVAHSLHQMHLQEVQ
IKPHENGEAIAFFPWQLNIFLKDINERDNMSFGGRQKLNAEYDILNLWNLPKGLGQKVKI
GSFSANAPEGQQLSLSEQMIQWAEGFSEIPQSVCSESCGPGFRKVTLEGKAICCYNCTPC
ADNEISNETDVDQCVKCPESHYSNTEKNHCLQKTVIFLAYEDPLGMTLACIALCLSALTA
FVIGVFVKYRDTPIVKANNRGLSYTLLITITFCLLCSLNFIGQPNTASCILQQNIFGVAF
TVALATVLAKAITVVLAFKATFPGRMVRWLMTSRAPNYIIPLCTLIQLFICGIWMTMSPP
FIHQDNHAEHGHILLLCNKGSSVAFHCVLGYLCSLAFGGYTMAFLSRNLPDTFNESKFLS
FSMVVFFCVWVTFLPVYHSTKGKVMVAVEVFSILASSTALLGFIFAPKCYIILFRPEKNS
FHRIKDKTYSRWNKI
Download sequence
Identical sequences E9PYS0
ENSMUSP00000130373 ENSMUSP00000130373 NP_001098040.1.92730 ENSMUSP00000130373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]