SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000130631 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000130631
Domain Number 1 Region: 54-490
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 8.07e-97
Family L-arabinose binding protein-like 0.0025
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000130631
Domain Number - Region: 515-562
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00651
Family TNF receptor-like 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000130631   Gene: ENSMUSG00000091544   Transcript: ENSMUST00000165611
Sequence length 855
Comment pep:known chromosome:NCBIM37:7:10512973:10538934:-1 gene:ENSMUSG00000091544 transcript:ENSMUST00000165611
Sequence
MKKMFIFMRVFFLLNITLLMANFIGPRCFWRINLDEIMDEYLGLSCAFILAAVQTPTEKD
YFNKTLNFLKTTTNHKYALALVFAMDEINRNPDLLPNMSLIIRYALGHCDGKTVTPTPYL
FHKRKKSPIPNYFCNEESMCSFLISGPNWKVSLSFWDYLDSFLSPRILQLTYGPFSSIFS
DDEQYPYLYQMAPKDTSLALAMVSFIHYFNWNWIGLVIPDDDQGNQFLLELKKQSENKEI
CFAFVKMISVDDVSFPQNTEMYYNQIVMSSTNVIIIYGETYNFIDLIFRMWEPPILQRIW
ITTKQLNFPTRKKDISHGTFYGSLTFLPHHGEISGFKNFVQTWFHLRNTDLYLLMQEWKY
FNYVSSASNCKILKNNSSDASFNWLMEQKFDMTFSENSHNIYNAVHAIAHALHEMNLQHA
DNQAIDNGKRASSHCLKVNSFLRRAYFTNPLGDKVFMKQRVIMQDEYDIIHFGNLSQHLE
IKMKLGKFSPYLPHGRHSHLYVDMIELATGRRKMPSSVCSAECSPGFRRLWKEGMAACCF
VCSPCPENEISNETNMDQCMNCPEYQYANTEQNKCIQKGVTFLSYEDPLGMALALMAFCF
SAFTALVLCVFVKHHDTPIVKANNRSLSYLLLMSLMFCFLCSFFFIGLPNRVICVLQQIT
FGIVFTVAVSTVLAKTVIVVLAFKVTDPGRRLRYFLVSGTPNYIIPICSLLQCVLCAIWL
AVSPPFVDIDEHTLHGHIIIVCNKGSDTAFYCILGYLACLALGSFSVAFLAKNLPDTFNE
AKFLTFSMLVFCSVWVTFLPVYHSTKGKHMVAVEIFSILASSAGMLGCIFVPKIYIILMR
PERNSTQKIREKSYF
Download sequence
Identical sequences E9Q5D8
NP_001098622.1.92730 ENSMUSP00000130631 ENSMUSP00000130631 ENSMUSP00000130631

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]