SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000131128 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000131128
Domain Number 1 Region: 54-505
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 7.46e-99
Family L-arabinose binding protein-like 0.00077
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000131128
Domain Number - Region: 515-573
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00424
Family Growth factor receptor domain 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000131128   Gene: ENSMUSG00000091504   Transcript: ENSMUST00000168440
Sequence length 853
Comment pep:known chromosome:NCBIM37:17:55731639:55763970:-1 gene:ENSMUSG00000091504 transcript:ENSMUST00000168440
Sequence
MMFTSIFIVLLLKLPLLLCNSAENMCFWRVKLNENCDGDLPQDCAFLLYTQVDPAPKDFL
KYLFKSCLPSKIHQYLLSLYFAMEEINSNPYLLPNVSLGIEYFKGKCNGYLSLFTNLNIM
TKYYHTFPNYICDPGACEIALTGPLWISSAQVATILQLKFIPQVRQITYGPFYPLLSDQS
KFPNLHQIAPKNRFLPEAIVSLLFHFSWIWVGLVIQDDDQGIQFLLDIKEEMQRNGVCLA
FVNVIPQNMHLFTTRAEKYYNQIITSSANVVILYGELNTALEVSFKHWKYLGTQKIWFTT
SQWDAITREKDFSLTSFYGTLTISQYHGDVSTLNNFFQGANLSKDTHYFSSERLGWMYFN
CSILKSNCKTPNQCTSSNLLEWLPRHSFDMAMNDESYNIYNAIYAVAHALHEMVLQKIDF
QQLENVTQLMQECVQIHAFLENMQFLNPIGDVVIINQQAKTDAEYEIYMIWNFPQGLGVK
VKIGRFYSYFLHDQKLYLYEDMIQWASGYSQIPPSVCSVSCAPGFKKFYLEEKPSCCFDC
SPCPENEISNATDLTQCVKCPDGQYANIERNHCFPKVVTYLAYADPLGIVLACMALFLSM
LSVLVLGIFVKNQYTPIVKANNRTLSYILLISLTLCFLCSLFFIGHPSTARCLLQQITFG
ILFTVAVSAVLAKTITVLLAFSITIPGRRVKWLLLFGTHKVIIPICSLFQLIICGFWLGL
SPPFVERDTHTEHGHIIIMCNKGSLIAFYSVLGYLGCLALASFIMAFLVRNLPDTFNEAK
FLTFSMLVFCSVWVTFLPVHHSTKGKAMVAVEVFSILASSAGLLGCIFIPKCYIIVLRPD
RNFIQRSKGKNHS
Download sequence
Identical sequences E9Q1C1
NP_001098052.1.92730 ENSMUSP00000131128 ENSMUSP00000131128 ENSMUSP00000131128 ENSMUSP00000138906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]