SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000131261 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000131261
Domain Number 1 Region: 35-502
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.08e-110
Family L-arabinose binding protein-like 0.00022
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000131261
Domain Number - Region: 510-569,632-649
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0157
Family Growth factor receptor domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000131261   Gene: ENSMUSG00000090851   Transcript: ENSMUST00000170424
Sequence length 857
Comment pep:known chromosome:NCBIM37:17:19190457:19218275:1 gene:ENSMUSG00000090851 transcript:ENSMUST00000170424
Sequence
MISWIFIFRLLQISNFFSAFSYNISTCYYKISEEFHREGDVVIGAFFPLHTFYSLKKMQH
STIPYYYLDNVIQYNFKNYQYILALQFAIEEINGNPNLLPNISLGFDFYNVRFTGKYILD
ITFNWLTALGERNYIPNYNCKKRNFTAALTGTSWITSAQIGTLLQLFKFPQINFGPYDLL
LSDRGQYSSLYQISPKDTSLSLAIVSLMVHFRWSWIGLILPNDHKGNKILSDFREEMERN
GICLAFVKMTSDTWTSYVAKFWENMDETNVTIIYGDIDSLEGIMRNIEQRLLTWNIWIMN
IEHHVIDRADYFILDSFHGSLIFKHSYRENFEFTKFIQTVNPNKYPEDVYLPKLWYLFFK
CSFSDTNCHVLGNCQTNASLEVFPSHIFDVAMNAESTSIYNGVYAVAHSLHEMRLQQLQM
QPYENPHGMVFFPWQLNSFLKDIEVKDKRSLDWRQTIDTEYDILNIWNMPKGLGLKVKIG
SFSANAPQGQQLSLSEQMIQWPAIFSEIPQSVCSESCGPGFRKVTLEGKAICCYKCTPCA
DNEISNETDVDKCVKCPERHYANKEKSNCFQKSVSFLAYEDPLGMAVASIALCLSALTAF
VIGIFVKHRDTPIVKANNRALSYILLITLTFCFLCSLNFIGKPTTASCILQQTTFAVAFT
MALGTVLAKAITVVLAFKISFPGRMVRWLMISRGPNYIIPISTLIQLIICGIWMATSPPF
IDQDAHTEYGHILILCNKGSAVAFHSVLGYLCFMALGSYAMAFLSRNLPDTFNESKFLSF
SMLVFFCVWVTFLPVYHSTKGKVMVAMEVFSILASSTALLVFIFGPKCYIILLRPDKNSF
NHIRKKTPSRKKKFPKI
Download sequence
Identical sequences E9PZ56
ENSMUSP00000131261 ENSMUSP00000131261 ENSMUSP00000131261 NP_001098020.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]