SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000131401 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000131401
Domain Number 1 Region: 2069-2227
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 9.45e-25
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0084
Further Details:      
 
Domain Number 2 Region: 2531-2588
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 1.83e-16
Family TSP-1 type 1 repeat 0.00032
Further Details:      
 
Domain Number 3 Region: 3989-4046
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000615
Family TSP-1 type 1 repeat 0.00032
Further Details:      
 
Domain Number 4 Region: 3228-3285
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000863
Family TSP-1 type 1 repeat 0.00036
Further Details:      
 
Domain Number 5 Region: 2694-2745
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000102
Family TSP-1 type 1 repeat 0.00061
Further Details:      
 
Domain Number 6 Region: 2960-3017
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000131
Family TSP-1 type 1 repeat 0.00057
Further Details:      
 
Domain Number 7 Region: 4241-4290
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000157
Family TSP-1 type 1 repeat 0.00092
Further Details:      
 
Domain Number 8 Region: 2805-2861
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000693
Family TSP-1 type 1 repeat 0.0005
Further Details:      
 
Domain Number 9 Region: 3797-3849
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000127
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 
Domain Number 10 Region: 3624-3668
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000654
Family TSP-1 type 1 repeat 0.00089
Further Details:      
 
Domain Number 11 Region: 1273-1336
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000000327
Family ATI-like 0.033
Further Details:      
 
Domain Number 12 Region: 3932-3989
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000458
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 
Domain Number 13 Region: 1414-1455
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000223
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 14 Region: 4758-4809
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000327
Family TSP-1 type 1 repeat 0.0015
Further Details:      
 
Domain Number 15 Region: 1565-1602
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000038
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 16 Region: 3066-3123
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000051
Family ATI-like 0.052
Further Details:      
 
Domain Number 17 Region: 2441-2477
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000589
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 18 Region: 3450-3498
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000824
Family TSP-1 type 1 repeat 0.00088
Further Details:      
 
Domain Number 19 Region: 1697-1747
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000863
Family TSP-1 type 1 repeat 0.0013
Further Details:      
 
Domain Number 20 Region: 1378-1414
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000916
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 21 Region: 3162-3228
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000955
Family TSP-1 type 1 repeat 0.0027
Further Details:      
 
Domain Number 22 Region: 2478-2531
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000017
Family TSP-1 type 1 repeat 0.0039
Further Details:      
 
Domain Number 23 Region: 2230-2267
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000223
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 24 Region: 468-528
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000235
Family BSTI 0.058
Further Details:      
 
Domain Number 25 Region: 3383-3442
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000301
Family TSP-1 type 1 repeat 0.00088
Further Details:      
 
Domain Number 26 Region: 824-884
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000327
Family ATI-like 0.044
Further Details:      
 
Domain Number 27 Region: 2899-2979
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000387
Family VWC domain 0.055
Further Details:      
 
Domain Number 28 Region: 4603-4656
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000405
Family TSP-1 type 1 repeat 0.0013
Further Details:      
 
Domain Number 29 Region: 4810-4868
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000445
Family BSTI 0.05
Further Details:      
 
Domain Number 30 Region: 1752-1791
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000536
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Domain Number 31 Region: 1813-1872
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000549
Family BSTI 0.053
Further Details:      
 
Domain Number 32 Region: 2381-2420
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000576
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 33 Region: 1454-1490
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000589
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 34 Region: 1494-1532
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000668
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number 35 Region: 4917-4978
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000602
Family ATI-like 0.016
Further Details:      
 
Domain Number 36 Region: 4968-5036
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000068
Family VWC domain 0.051
Further Details:      
 
Domain Number 37 Region: 4046-4105
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000159
Family ATI-like 0.05
Further Details:      
 
Domain Number 38 Region: 4145-4199
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000017
Family TSP-1 type 1 repeat 0.0015
Further Details:      
 
Domain Number 39 Region: 874-942
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000188
Family Fibronectin type I module 0.025
Further Details:      
 
Domain Number 40 Region: 4413-4469
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000229
Family ATI-like 0.016
Further Details:      
 
Domain Number 41 Region: 1605-1642
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000249
Family LDL receptor-like module 0.0022
Further Details:      
 
Domain Number 42 Region: 3869-3916
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000314
Family TSP-1 type 1 repeat 0.0014
Further Details:      
 
Domain Number 43 Region: 2753-2801
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000366
Family TSP-1 type 1 repeat 0.0017
Further Details:      
 
Domain Number 44 Region: 2611-2656
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000687
Family ATI-like 0.033
Further Details:      
 
Domain Number 45 Region: 4669-4719
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000719
Family ATI-like 0.085
Further Details:      
 
Domain Number 46 Region: 977-1018
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000103
Family VWC domain 0.072
Further Details:      
 
Domain Number 47 Region: 4303-4353
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000144
Family TSP-1 type 1 repeat 0.0036
Further Details:      
 
Domain Number 48 Region: 3022-3061
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000183
Family TSP-1 type 1 repeat 0.0039
Further Details:      
 
Domain Number 49 Region: 3295-3346
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000278
Family BSTI 0.029
Further Details:      
 
Domain Number 50 Region: 2861-2926
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000703
Family ATI-like 0.053
Further Details:      
 
Domain Number 51 Region: 3506-3566
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000899
Family ATI-like 0.041
Further Details:      
 
Domain Number 52 Region: 1909-1967
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000981
Family TSP-1 type 1 repeat 0.0016
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000131401
Domain Number - Region: 4196-4258
Classification Level Classification E-value
Superfamily FnI-like domain 0.000199
Family Fibronectin type I module 0.084
Further Details:      
 
Domain Number - Region: 1658-1683
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000223
Family LDL receptor-like module 0.0029
Further Details:      
 
Domain Number - Region: 4356-4405
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000301
Family TSP-1 type 1 repeat 0.0048
Further Details:      
 
Domain Number - Region: 3673-3730
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000811
Family BSTI 0.045
Further Details:      
 
Domain Number - Region: 1965-2027
Classification Level Classification E-value
Superfamily FnI-like domain 0.00167
Family Fibronectin type I module 0.077
Further Details:      
 
Domain Number - Region: 527-567
Classification Level Classification E-value
Superfamily FnI-like domain 0.00262
Family VWC domain 0.056
Further Details:      
 
Domain Number - Region: 5046-5136
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 0.00481
Family Gonadodropin/Follitropin 0.011
Further Details:      
 
Domain Number - Region: 4116-4144
Classification Level Classification E-value
Superfamily PMP inhibitors 0.0439
Family PMP inhibitors 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000131401   Gene: ENSMUSG00000029797   Transcript: ENSMUST00000169350
Sequence length 5142
Comment pep:known chromosome:NCBIM37:6:48398228:48451249:1 gene:ENSMUSG00000029797 transcript:ENSMUST00000169350
Sequence
MLPLALLFGMLWTQANGHWCEQIETVHVEEEVTPRQEDLVPCTSLYHYSRLGWQLDLSWS
GRVGLTRPPALGLCAIYKPPETRPATWNRTVRACCPGWGGAHCTDALAETSPKGHCFVTW
HCQPLAGSANSSAGSLEECCAQPWGHSWWNSSSQMCLSCSGQHRPGNASSEGLLQPLAGA
VGQLWSQRQRPSATCATWSGFHYQTFDGHHYHFLGQCTYLLAGAMDSTWAVHLRPSVHCP
QHRHCWLVQVVMGPEEVLIQDGEVSVKGQPVPVGEPQLLHGMSLQWQGDWLVLSGGLGVV
VRLDRSSSISISVDHEFWGRTQGLCGLYNGRPEDDFVEPGGGLATLAATFGNSWKLPGSE
PGCLDAVEVAWGCESLLGGTLTDLEAVKLQAQAQDMCHQLLEGPFWQCHGQVQPDEYHET
CLFAYCVGATAGNGPEGQLEAVCATFANYAQACARQHIYVHWRKPGFCERVCPGGQLYSD
CVSSCPPSCSAVAQGEEGSCGKECVSGCECPTGLFWDGALCVPAAHCPCYHRRQRYAPGD
TVKQQCNPCVCQDGRWHCAQALCPAECAVGGDGHYFTFDGRSFFFRGTPGCHYSLVQDSV
KGQLLVVLEHGACDTGSCLHALSVFLGNTHIQLRYSGAVLVDGEDVDLPWIGVEGFNISW
ASSTFLLLHWPGAWVLWGVAEPAAYITLDPRHAYQVQGLCGTFTWKQQDDFLTPAGDIET
SVTAFASKFQVSGDGRCPLVDKSPLFCSSYSQHLTFTEAACAILHGHAFQECHGLVDREP
FRLRCLEAVCGCAPGRDCLCPVLSAYTRHCAQEGVLLQWRNETLCPVSCPGGQVYQECAP
VCGHHCGEPEDCKELGICVAGCNCPPGLLWDLEGQCVPPSMCHCQFGGHRYTINTTTVRD
CSHCICQERGLWNCTAHHCPRQWALCPRELIYVPGACLLTCDSPRANHSCWAGSTDGCVC
PPGTVLLDKHCVSPDLCPCRHNGQWYPPNATIQEDCNICVCQGQRWHCTGQRCSGWCQAS
GAPHYVTFDGLVFTFPGACEYLLVREAGGRFSVSVQNLPCGASGLTCTKALVVRLDSTVV
HMLRGQAVTVNGVSIRLPKVYTGPGLSLHHAGLFLLLTTRLGLTLLWDGGTRVLVQLSPH
FHGRVAGLCGNFDSDASNDLRSRQGVLEPTAELTAHSWRLNPLCPEPGDLPHPCTVNAHR
ANWARARCEVILQPIFAPCHTEVPPQQYYEWCVYDACGCDTGGDCECLCSAIATYADECA
RHRHHVRWRSQELCPLQCEGGQVYEPCGSTCPPTCHDHHSELRWHCQVITCVEGCFCPEG
TLLHGGACMKLAACPCEWQGSFFPPGTVLQKDCGNCTCQGSQWHCDRGGAPCEDMEPGCA
EGETLCRENGHCVPLEWLCDNQDDCGDGSDEEGCATSVCGEGQMSCQSGHCLPLSLICDG
QDDCGDGTDEQGCLCPHGSLACADGRCLPPALLCNGHPDCLDAADEESCLGPVSCISGEV
SCVDGTCVRTIQLCDGVWDCPDGADEGPSHCSLPSLPTPPGGIGQNPSTSSLDTAPSPVG
STSPASPCSLLEFQCNSGECTPRGWRCDQEEDCTDGSDELDCGGPCMLYQVPCAHSPHCV
SPGQLCDGVTQCPDGSDEDPDVCEEQSASGGANRTGAPCPEFSCPDGTCIDFLLVCDGNP
DCELADETEPSLDEQGCGAWGSWGPWAPCSQTCGSGTRSRNRNCSTSSLQVLQNCPGLQH
QSQACFTEACPVDGEWSSWSPWSPCSEPCGGTTTRHRQCRPPQNGGQDCALLPGSTHSTR
QTSPCPQEGCLNATCFGELVFRTCAPCPLTCDDISGQAACPPDRPCSSPGCWCPDGKVLN
TEGQCVRPRQCPCLVDGAHYWPGQRIKMDCQLCFCQDGQPHRCRPNPECAVDCGWSSWSP
WAECLGPCSSQSLQWSFRSPNNPRLSGHGRQCRGIHRKARRCQTEACEGCEQWGLMYNVG
ERWRGGPCMVCECLHSSITHCSPYCPIGSCPQGWVLVEGMGESCCHCALPEKNQTVIHMT
TPAPAPASAPSPQIGAHLVTYVLPPTADACYSPLGLAGLPMWAPSQHWEHITRADPVEAP
MAGPGPREGASAEWHTQPLYLQLDLRRPRNLTGIIVQRAGSSAAYVSTLSLQFSSDNLQW
HNYVNSLSSTLSPPKPSPESSNHMAPEVWTFDQMVQARYIRVWPHSGHLRDNNQHDIFLW
VELLGLSPLAPLCPGSRHRCASGECAPKGGPCDGAVDCDDGSDEEGCGSLHASTTSRVHP
MTRTPALSPTQPGKFPREGLPDTEPQQPKQESSLPGAAGLIPASEGTLPVSGQPMQTLSA
TSTFPPGAKSLHPGMAAVTVHPPHSVTPGAPVGQTVSPRPFPPMPCGPGQVPCDVLGCVE
QEQLCDGREDCLDGSDEQHCASAEPFTVPTTALPGLPASKALCSPSQLRCGSGECLPFEH
RCDLQVNCQDGSDEDNCVDCVLAPWSGWSDCSRSCGLGLIFQHRELLRLPLPGGSCLLDQ
FRSQSCFVQACPVAGAWAEWGPWTACSVSCGGGHQSRQRSCVDPPPKNGGAPCPGPSHEK
APCNLQLCPGDTDCEPGLVHVNAELCQKGLVPPCPPSCLDPEANRSCSGHCMEGCRCPPG
LLLQDSHCLPLSECPCLVGQKLIQPRLAFLLDNCSQCICEKGTLLCKPGACSQSCGWSAW
SPWTACDRSCGSGVRARFRSPTNPPVAFGGSPCEGDRQELQACYTDCGTEIPGWTPWTSW
SSCSQSCLVPGGDPGWRQRSRLCPSSRDTFCPGEATQEEPCSPPVCPVPSAWGLWASWST
CSASCNGGIQTRGRSCSGSAPGNPVCLGPHTQTRDCNMHPCTAQCPGNMVFRSAEQCLEE
GGPCPQLCLAQDPGVECTGSCAPSCNCPPGLFLHNASCLPRSQCPCQLHGQLYAPGAVAH
LDCNNCTCISGEMVCTSKRCPVACGWSPWTPWSPCSQSCNVGIRRRFRAGTEPPAAFGGA
ECQGPNLDAEFCSLRPCRGPGAAWSSWTPCSVPCGGGYRNRTQGSGPHSPIEFSTCSLQP
CAGPVPGVCPEDQQWLDCAQGPASCAHLSIPGEANQTCHPGCYCLSGMLLLNNVCVPVQD
CPCAHRGRLYSPGSAVHLPCENCSCISGLITNCSSWPCEEGQPAWSSWTPWSVCSASCNP
ARRHRHRFCARPPHRAPFSLVLLTTVAAPTTLCPGPEAEEEPCLLPGCNQAGGWSPWSPW
SGCSRSCGGGLRSRTRACDQPSPQGLGDFCEGPQAQGEACQAQPCPVTNCSAMEGAEYSP
CGPPCPRSCDDLVHCVWRCQPGCYCPLGKVLSADGAICVKPSYCSCLDLLTGKRHHAGTQ
LMRPDGCNHCTCMEGRLNCTDLPCQVSGDWCPWSKWTACSQPCRGQTRTRSRACVCPAPQ
HGGSPCPEESGGTGVQHQMEACPNATACPVDGAWSPWGPWSSCDACLGQSYRSRVCSHPP
ISDGGKPCLGGYQQSRPCRNSSTLCTDCGGGQDLLPCGQPCPHSCQDLSLGSTCQPGSAG
CQSGCGCPPGQLSQDGLCVFPVDCHCHFQPRAMGIPENRSRSVGSTLSSWESLEPGEVVT
GPCDNCTCVAGILQCHEVPSCPGPGIWSSWGPWEKCSVSCGGGEQLRSRQCARPPCPGLA
QQSRICHIHVCRGCPAGRLYRECQPSDGCPFSCAHVTGQVACFSERCKEGCHCPEGTFQH
HVACVQECPCVLTVLLLQELGLASAALGSYPTLLGDEGKPLGPGVELLPGQMLQTDCGNC
SCVHGKLSCSMVECSRVHGSFGPWGMWSLCSRSCGGLGTRTRTRQCVLPTLAPGGLSCRG
PLQDLEYCFSPECPGTAGSTVEPVTGLAGGWGPWSPWSPCSHSCTDPAHPAWRSRTRLCL
ANCTVGDSSQERPCNLPSCAALLPCPGPGCGSGNCFWTSWAPWEPCSRSCGVGQQRRLRA
YHPPGPGGHWCPDILTAYQERRFCNLRACPVPGGWSHWSPWSWCDRSCGGGRSLRSRSCS
SPPPKNGGTSCVGERHHVRPCNPMPCEEGCPAGMEMVSCANHCPYSCSDLQEGGMCQEDQ
ACQLGCRCSEGFLEQDGGCVPVGHCECTDAQGRSWAPGSQHQDACNNCSCQAGQLSCTAQ
LCSPPAHCAWSHWSAWSSCSHSCGPQGQQSRFRSSTSGSWALECQKEQSQSQPCPEVPCP
PLCLHEAHLHELGDNWLHGECQQCSCTPEGAICKDTDCAVPRGWTLWSSWSYCSVSCGGG
SQVRTRSCTVSAPPHGSLSCEGPDTQTRHCGQQLCLQKLERCSWGPWGPCSRSCGTGLAS
RSGSCPCLLTKEDSKCNDTFLGLDTQACYSGPCQDDCTWGDWSSWTRCSCKVLVQQRYRH
QVPAPGQAGEGTPCTRLDGHFRPCTIGNCSEDSCPPPFEFQSCGSPCAGLCATHLNHRLC
QDLPPCQPGCYCPKGLLEQAGSCILPEQCNCWHISGEGARVTLAPGDRLQLGCKECVCRR
GELQCSSQGCEGLLPLTGWSEWSPCGPCLPQSALAPASRTALEGHWPLNTSDLPPPSVTL
LASEQYRHRLCLDPETRRPWAGDPALCTVPLSQQRLCPDPGACNDTCQWGPWGPWSPCQM
PCSGGFKLRWRVARDTSAGECPGPWAQTESCNMGSCPGESCETRDTVFTLDCANQCPRSC
ADLWDGVQCLQGPCSPGCRCPPGQLVQDGHCVPISSCRCGLPSANASWELAPTQVVQLDC
HNCTCINGTLMCPHLECPVLGPWSAWSECSAVCGKGTMVRHRSCEEHPDREPCQALDLQQ
WQECNLQACPECPPGQVLSTCATMCPSLCSHLWPGTICVREPCQLGCGCPGGQLLYNGTC
IPPEACPCTQFSLPWGLTLPLEEQARELPSGTVLTRNCTHCTCQGGAFICSLTDCQECAP
GEIWQHGKLGPCEKTCPEMNMTQAWSNCTEAQAPGCVCQLGYFRSQTGLCVPEDHCECWH
HGSPHLPGSEWQEACESCRCLHGKSVCIRHCPELSCAQGEVIMQEPGSCCPICQQDTLST
EEEEPVSCRYLTELRNLTKGPCHLDQIEVSYCSGHCRSSTNVMTEEPYLQSQCDCCSYRL
DPDSPVRILNLLCPDGHTEPVVLPVIHSCQCSACQGGDFSKH
Download sequence
Identical sequences ENSMUSP00000131401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]