SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000131426 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000131426
Domain Number 1 Region: 34-509
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 6.06e-114
Family L-arabinose binding protein-like 0.00039
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000131426
Domain Number - Region: 518-578,641-656
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00314
Family Growth factor receptor domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000131426   Gene: ENSMUSG00000091381   Transcript: ENSMUST00000167976
Sequence length 864
Comment pep:known chromosome:NCBIM37:10:78931703:78954899:1 gene:ENSMUSG00000091381 transcript:ENSMUST00000167976
Sequence
MLFSCLFFTWLLQMPTLIWTFATSSCLSESEYLLHHDGTVVIGAFFPILKSLPVSETIDW
KTLSFDIDNVLEMNVHNYQLVLTMLFAINEINLNSHILPNTSLGLEIYNVPYLQRNALRN
VFYWLTGLSTFIPNYSCRKNSKSAATLTGILWKTSENIGTVLDLYKFPQITFGPFDHDQI
DRKQFPSLYQVAPKDTSLLSGIASLMLHFNWTWVGLLSTDDHRGAQFLSDLRKVLENNTV
CIAFMETVSLWGESLNSLQTHYQMHILESSANVIVIYGSIAFILTVIKNRHSKYITKKVW
VMNSKWVGQKFEQYTMLELSHGALSFSHHHGEIFGFTNFVHEATPFKYPEDIFLHVLWNK
YFNCSLLQSDCKIIEKCLPNSSLELLPGNIFEMIMTEESYNVYNAVYAVAHSLHEMTLSQ
MQVQPQAYKDRTMLFPWQLHPFLRNIEVKNSVGDHVVLDWKRKTDTKYDIFNVWNFPTGL
SLLVKVGTFAPSAPKEEQFSISEHIIDWPIGFTETPHSVCSESCSPGFRKVVLESKPTCC
FDCTPCPDNEISNETGAVQCVKCPETHYANAEKRHCLKKTVTFLDYNDPWGKGLTLMSLG
FSALTTLIIGVFVNHRDTPIVKANNRSLTYILLITLALCFLCPLLFIGHPNTVTCIMQQN
LFGLLFTVVLSTVLAKTITVVMAFKIAVPGRKLRLLLISQVPNFIIPVCTLIQVCLSGIW
LGTFPPFIDMDAHSEYGHIIILCNKGSAIAFYCTLAYLGVMAIGSYLMAFLSRSLPDTFN
EAKFLAFSMLVFCAVWVTFLPVYHSTTGKVMVAMEMFSILASSSSLLILIFVPKCYIILF
RPERNTVHHIRDERHDRSKNLLKT
Download sequence
Identical sequences E9Q0G7
NP_001098007.1.92730 ENSMUSP00000131426 ENSMUSP00000131426 ENSMUSP00000131426 PGOMOU00000128164

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]