SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000131447 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000131447
Domain Number 1 Region: 44-504
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.45e-109
Family L-arabinose binding protein-like 0.0022
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000131447
Domain Number - Region: 512-559
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00989
Family TNF receptor-like 0.011
Further Details:      
 
Domain Number - Region: 607-814
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.0209
Family Calcium ATPase, transmembrane domain M 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000131447   Gene: ENSMUSG00000091076   Transcript: ENSMUST00000168175
Sequence length 857
Comment pep:known chromosome:NCBIM37:17:23480944:23497095:1 gene:ENSMUSG00000091076 transcript:ENSMUST00000168175
Sequence
MFTLIFLFWLLNIPLLLADFISPRCFWKMKQNENRDRNQGTGCTFMIHAVQRPVEKEYFS
HILNIQTHTENHKYALALAFSIYEINMNPDILPNMSLIFEFSVHNCVWESKLMSFMHVSL
QNYDIFPNYLCKEYTKCAMALTSLNWATTVKFNTILNNFISQQFFQITYGPFHPVLSDHE
KFPYLHQMASDHTSLAFGLVSFIIHFGWNWVGLVISDNDQGIQFLSYLKTEMEKNTICFA
FVNMIPMSMNLYMSKAEVYYNQIMTSSTNVVIIYGDTDSTLAVSFRMWESLGIQRLWITT
SQWNVSPGMKDFTFGNEYGTFAFGQHHSEISGFKHFVQTLNSVKCPDEYLVKLEWMHFNC
EVSASKCKTLKNCSSNHSLEWLMVHTFDMAFIEGSYDIYNAVYAFAHALHQITFQKFDNL
PKDNGKEHNYSCKKLYSFLRKTQFINPVGDRVNMNQRDKLQEEYDIFYIWNFPHGLGFKV
KIGIFSPYFPNGQQVHLSEDMIEWAKGSAQMPTSVCSADCGPGSRKFRMDGMAACCFHCK
PCPENEISNETNVDYCVQCLEDQYANTEQNHCIRKIVVFLSYEEPLGVALSLISLFFSAF
TIVVLGVIVKHHSTPVVKANNRTLTYILLISLIFCFLCPLLFIGHPNAATCILQQITFGI
VFTVSVSTVLAKTITVVLAFKIIASQRMMKYFLVSGAINYIIPVCILIQVIVCAVWLGAS
PPSVDIDGQSEHGQIIIVCHKGSVNAFYCVLGYLATLAIGSFTLAFFSRNLPGAFNEAKS
ITFSMLVFCSVWVTFIPVYHSTKGKVMVAVEIFSTLASSAGMLGCIFVPKCYTILFRPDQ
NSLEMIRVKSSSNARSS
Download sequence
Identical sequences D7URW4 E9Q0E7
NP_001098049.1.92730 ENSMUSP00000131447 ENSMUSP00000131447 ENSMUSP00000131447

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]