SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000131450 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000131450
Domain Number 1 Region: 47-500
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.31e-108
Family L-arabinose binding protein-like 0.0036
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000131450
Domain Number - Region: 507-556
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00989
Family TNF receptor-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000131450   Gene: ENSMUSG00000091879   Transcript: ENSMUST00000171841
Sequence length 849
Comment pep:known chromosome:NCBIM37:5:109849032:109882406:1 gene:ENSMUSG00000091879 transcript:ENSMUST00000171841
Sequence
MKKLCVFTISFLLMTFSLFLCSLTGPSCFWRIQNNEDNDGDLHRDCGFFLFTSEEPIKED
FYHFCIDFRIPARRYEVFLVMFFATDEINRNPYLLPNMSLIFCLIVGMCGDTLGYLEETH
SPNNTWNSINYNCEIRPICDIELTGPSWTTSVKLAINSRKPKVFFGPFNSHLSDHDQFPY
IYQVATKDTHLSHGMVSLMLHFRWTWIGLVISDDDQSIQFLSDLREAMQRHGICLAFVNM
IPENMQIYMTRGKIYDKQIMTSSAKVVIIYGEMNSTLEVSFRRWAYLCARRIWITTSQWD
VITNKRDFSFDFFHGTVTFAHHNGEIVIFRNFLQTVNTSKYPLDISQTMQEWNYFNCSIS
KNSNSKMDHFTFNNTLEWTALQKLNMVLSEEGYNLYNAVYAVAHTYHELILQQVEFQKMA
EPKGIFTDCQQVASLLKTRVFTNPVGELVNMKHRENQCADYDIFNIWNFPQGLGLRVKIG
SYYPCFPQNQQLHISEDLEWATGGTSVPTSMCSVTCTAGFRKIHQKQTADCCFDCAHCPE
NEVSNETADMEQCVRCPDDKYANLEQTHCLQRAVSFLAYEDPLGMALGCMALCFSALTLL
VFFTFVKYKDTPIVKANNRILSYILLISLVFCFLCSLLFIGHPNQATCILQQTTFGVFFT
VAISTVLAKTITVVMAFKLTAPGRRVRGMLVAGAPNLAIPICTLIQIVLCGIWLVTSPPF
IGRDTKSEHGKTILICNKGSVIAFHFVLGYLGSLALGSFTVAFLARNLPDRFNEAKFLTF
SMLMFCSVWITFLPVYHSTRGKAMVVVEVFSILASSAALLGFIFVPKCYVILVKSDSNFR
EKYKNKFHY
Download sequence
Identical sequences E9PYF5
NP_001098098.1.92730 ENSMUSP00000131450 ENSMUSP00000131450 ENSMUSP00000131450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]