SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000131564 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000131564
Domain Number 1 Region: 1-310
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.04e-73
Family L-arabinose binding protein-like 0.0032
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000131564
Domain Number - Region: 318-377,440-457
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0251
Family Growth factor receptor domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000131564   Gene: ENSMUSG00000091679   Transcript: ENSMUST00000165692
Sequence length 664
Comment pep:known chromosome:NCBIM37:17:18718691:18735121:1 gene:ENSMUSG00000091679 transcript:ENSMUST00000165692
Sequence
MAPKDTSLSLAIVSLMVHFRWTWVGLILPNDHKGNKILSDFREEMERNGICLAFVKMTPE
TWTSYVAKFWENMDETNVTIIYGEIDSLEGIMRNIEQRLLTWNVWIMNIEHHVIDRADYF
MLDSFHGSLIFKHNYRENIEFTKFIQTVNPNKYPEDIYLPKLWYLFFKCSFSDTNCHVLE
NCQTNATLDIFPRHIFDMVMNAESTIIYNGVYAVAYSLHEMRLQLLQMQPYENHHGMVFF
PWQLNTFLKNIVVKDKRSLDWRQTIDAEYDILNIWNLPKGLGLKVKIGSFSANAPLGQQL
SLSEQMIQWPAMFSEIPQSVCSESCGPGFRKVTLEGKAICCYKCTPCADNEISNETDVDT
CVKCPERHYANAEKSNCFQKSVSFLAYEDTLGMALASIALCLSVLTAFVIGIFVKHRDTP
IVKANNRALSYILLITLTFCFLCSLNFIGKPTTVSCILQQTTFAVAFTMALATVLAKAIT
VVLAFKVSFPGRMIRWLMISRGPNYIIPICTLIQLLICGIWMATSPPFIDQDAHTEYGHI
IILCNKGSSVAFHSVLGYLCFMALGSYAMAFLSRNLPDTFNESKFLSFSMLVFFCVWVTF
LPVYHSTKGKVMVAMEVFSILASSTALLAFIFGPKCYIILLRPDKNSFNYIRKKTPSRKN
FPKI
Download sequence
Identical sequences E9PZU5
ENSMUSP00000131564 ENSMUSP00000135095 ENSMUSP00000131564 NP_001098017.1.92730 ENSMUSP00000131564

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]