SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000131831 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000131831
Domain Number 1 Region: 2-435
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 4.37e-104
Family L-arabinose binding protein-like 0.0000225
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000131831   Gene: ENSMUSG00000090581   Transcript: ENSMUST00000165012
Sequence length 824
Comment pep:known chromosome:NCBIM37:3:64341483:64363740:-1 gene:ENSMUSG00000090581 transcript:ENSMUST00000165012
Sequence
MKTMIHTIKEINERKDILPNHTLGYQIFDNCFSTTKAMESSSVFLTGQDEYKSNWRNSTG
KFLVGIIGAGGSTMSAAVSRIVGIHNVPQVGYASSSSIFSNDIQFPYILRTIPSDKFQSE
AIVNLIRHFGWVWVGAIASDDDYGKYGVRFFREEMERANLCVAFSETIPKVYSNEKMKIA
VDAVKSSTAKVIVLYATDIDLCPFVLEVIHHNITDRTWIATEAWITSALIAKPEYFPYFG
GTIGFAVPRSVIPGLKEFLYDVHPSKDPNDVLTIEFWQTAFNCTWPNSTVPYNVDHRVNM
TGKEDRLYDMSDQLCTGEEKLQDLKSTYLDTSQLRITNNVRQAVYLLAHAIDRFSQADIR
EEYRESAVLENKPDFESGKLWLYLTKIKFITHDGKKIELGSNGDVLNGSYDILNWHMDNT
GEITFVKVGEYKFTSSKYEFVLPKNSTLFWNTESSRLPDSVCTKVCPPGTRKGIHQGQPI
CCFDCIPCTDGYVSEKPGQRLCDPCGENDWSNAEKNKCVPKHVEFLAYEEALGFTLVILS
IFGALVVLAVTVVYVIHRHTPLVKANDRELSFLIQVSLGITVLSSMLFIGKPCNWSCKTR
QVTLALGFCLCLSSILGKTVSLFFAYRISISKTRLISMHPIFRKLIVLICVVGEIGVCTT
YLVLEPPSLFKNIEPQNVKIIFECNEGSIEFLCSIFGFDVLLALLCFVTTFVARQLPDNY
YEGKCITFGMLVFFIVWISFVPAYLGTKGKFNVAVEIFAILASSYGLLGCVFLPKCFIIL
LRPKRNTDETVGGRVPTVDRSIQLTSASVSSELNSTTVSTVLDE
Download sequence
Identical sequences L7N478
NP_001098089.1.92730 ENSMUSP00000131831 ENSMUSP00000131831

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]