SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000131856 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000131856
Domain Number 1 Region: 32-507
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 6.28e-126
Family L-arabinose binding protein-like 0.00017
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000131856
Domain Number - Region: 505-576
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000837
Family Growth factor receptor domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000131856   Gene: ENSMUSG00000092032   Transcript: ENSMUST00000168489
Sequence length 865
Comment pep:known chromosome:NCBIM37:7:49267162:49314351:-1 gene:ENSMUSG00000092032 transcript:ENSMUST00000168489
Sequence
MFWILTFVFLYIPICLCAFTDNECYVINSEFFYHEGDVTIGAFFPLHIYYTGNKVPDKYM
PYSFQDYHVQYKFKNYQFVLALLFAIEEINRNPDLLPNTTIGYGIYNIPYTEKNILYRAF
IWHTGKINSFPNFDCGHKRKSPAILTGPSWSTSAHIGTFLQLYKIPQVTFGPFDSILNDR
GQFNSLYQMAPKDTSLSLAIVLLLLHFHWSWVGLILPDDHRGTQILLDLRENMENHGICI
AFLKMISGTWNAYSNEQWKNMEKIEESSANVIVIYGDITSVQGLMRHIAQLLVTWKVWVL
NSSWDVDTHSDYFMVESFHGSLVFSHHREEMVEFMNFVQTVNPYKYPEDTYLPKFWHLFF
KCSFSEFDCQLLENCQPNASLDLLPRHQFEPVMGEEGYHIYNAVYAVAYSLHEMNLQQIQ
TQPYPNGEEKELSPWQLHPFLQNTIMRSHARRQIAMHGGGNLDSQYDILNFWNFPSGFGL
KVKVGTYSLNAPQGLQLSLCEQMIQWPTGFTKIPRSVCSESCRPGFRKAAKEGKAVCCFD
CTPCADNEISNETDMDQCVKCPESHYANSERNHCLQKSVSFLAYEEPLGMALTITAICFS
LLTALVLAVFVKNRDTPIVKANNRALSYILLLTLFICLLSSLLFIGQPNTITCILQQTAF
GILFTVALSTVLAKAITVVIAFKATVPARMMRWLMISRAPNFIILICTLIQVIICGIWVV
TSPPFIDQDTQAEHGHIIIVCNMGSTVAFHTVLGYLCSLALGSYTMAFLSRNLPDTFNEA
KFLSFSIQVFFCVWITFLPVYHSTKGKVMVAMEVFSILASSIALLGLIFGPKCYIILLRP
EKISCLGIRHKKHSRRNINLNLVKN
Download sequence
Identical sequences E9PUT5
NP_001098526.1.92730 ENSMUSP00000131856 ENSMUSP00000131856 ENSMUSP00000131856

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]