SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000131925 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000131925
Domain Number 1 Region: 2-433
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.12e-110
Family L-arabinose binding protein-like 0.00000762
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000131925
Domain Number - Region: 457-505
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0471
Family TNF receptor-like 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000131925   Gene: ENSMUSG00000068999   Transcript: ENSMUST00000170270
Sequence length 824
Comment pep:known chromosome:NCBIM37:3:64294743:64311607:-1 gene:ENSMUSG00000068999 transcript:ENSMUST00000170270
Sequence
MKTMIHTIKEINERKDILPNHTLGYQIFDTCFSVSKAMETAMTLLTGQEEKKPNYRNSTG
KYLVGIIGSGGSSLSVTAARIFGLYYMPQVGYTSSSAILSDKFQFPSFYRSIPSDKIQIE
AMVTLIIHFGWVWVGAIASEDDYGKYGVKSFREKMETANLCVAFSETIPKVYSNERMQKA
VKAIKSSSAKVIVLYTSDIDLSPFVLEVIHHNITHRTWIASEAWITSALIAKPEYFPYFG
GTIGFAIPRSVIPGLKEFLYDVHPSKDPNDVLTIEFWQTAFNCTWPNNSVPYNVDHRVNM
TGKEDRLYDMSDQLCTGEEKLEDLKNTYLDTSQLRITNNVRQAVYLMAHALDHLSNCDLL
EEQRNNTACSHIPDFEPKELLPYFKKLKITTHDGAEIELNGNGDVDSGYYDILNWHMGDA
GEITFVKVGEYIFNSTKYELVLPKNSSLFWNTESSRLPDSVCTKLCAPGTRKGIRPGQPL
CCFACIPCADGYVSEKPGQRECDPCGEDDWSNAEKSKCVPKLVEFLAYEEALGFTLVILS
IFGALVVLAVTAVYVVHRHTPLVKANDRELSFLIQMSLGITVLSSMLFIGKPCNWSCMAR
QITLALGFCLCLSSILGKTISLFFAYRISISKTRLISMHPIFRKLIVLICVLAEICVCAV
YLVLEPPKMFKNIEIQNVKIIFECSEGSIEFLCSIFGFDVLLALLCFLTTFVARQLPDNY
YEGKCITFGILVFFIVWISFVPAYLSTKGKFKVAVEIFAILASSYGLLGCVFLPKCFIIL
LRPKRNTDETVGGRVPTVDRSIQLTSASVSSELNSTTVSTVLDE
Download sequence
Identical sequences L7N2D3
ENSMUSP00000131925 NP_001098088.1.92730 ENSMUSP00000131925

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]