SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000132206 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000132206
Domain Number 1 Region: 51-433
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 8.75e-93
Family L-arabinose binding protein-like 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000132206   Gene: ENSMUSG00000090355   Transcript: ENSMUST00000164327
Sequence length 434
Comment pep:known chromosome:NCBIM37:17:23066355:23069908:-1 gene:ENSMUSG00000090355 transcript:ENSMUST00000164327
Sequence
MFTLILLFLLLNIPLIVADFIDPRCFWRIKQNKDEDGNLGSGCSFFIQAVQWPVEKEYFS
SILNTQTHTENHKYALVLAFSINEVNRNSDLLPNMSLIFTFSALICDYESQLKSLIHLSL
QNHEIFPNYICNDDVCAVALTGLNWTTTLTLYTILNNFISHQFLHLTYGPFHPVLSDHEE
FPYLYQMASEDTSLALAMVSFIIHFSWNWVGLAISDNDKGIQFLSYLRREMEKNTVCFAF
VSMIPVNMHLYMTRTEVYYNQIMTSSTNVVIIYGDTDSTLAVSFRMWESLDIKRIWVTTS
QWAITTGKKDFTFNNLYGTFAFGHHHGEISGFKNFVQTLNLLKYSDEYLVKLEWMYFNCE
VSAPKCKTLKNCSSNHPLEWLMVRTFDMAFTEGSYAIYNAVYAVAHALHELTFQKFDNLP
TDNVKEQNYACNKV
Download sequence
Identical sequences ENSMUSP00000132206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]