SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000132299 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000132299
Domain Number 1 Region: 35-510
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.01e-109
Family L-arabinose binding protein-like 0.00082
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000132299
Domain Number - Region: 518-564
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000942
Family TNF receptor-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000132299   Gene: ENSMUSG00000091888   Transcript: ENSMUST00000165834
Sequence length 863
Comment pep:known chromosome:NCBIM37:10:78611561:78657678:1 gene:ENSMUSG00000091888 transcript:ENSMUST00000165834
Sequence
MLFSLFIFFWFLNMPTFTWIIATDICPTDTKYLIHYDGTVVIGAFFPILHNSPISLTTEW
KYLPMDTDNYFGMSERNYQLVLAMLFAINEINLNSHILPNTSLGLEIYNLPAIGRNIFRT
VFSWLTGLSSVIPNYTCRKESNSAVTLTGVSWKTSETIWTILDLYKFPQLTFGPFDPVQI
DRNQFQSLYQMAPKDTALLSGIASLMLHFSWNWVGLIITDDHRGAQFLSDFRKELDKTRI
CIAFVQTVLYLEETLLHLLSQNLIHFLESSTADVIVIYGPTSILLTLIESTYRKYNMKKI
WIMNSKWFCPNLELYNMIELSHGALIFSPHYEEITGFKKFMQEATPNKYPEDIFLHLLWY
WHFNCSFLHSECKIFENCLQNASLELLPGNIFTMTMTEESYNVYNAVLAVAYSLHEKTLS
QIQFQPQANIDRTLLFPWQLHPFLKKIQVKNSVGDHVVLDWKRKADPEYDITNIWNFPTG
LSQLVKVGTFVPSAPKGEQLSISEYMINWPIGFTEIPHSVCSESCSPGFRKVALESKPTC
CFDCTPCPDNEISNETDLDQCVHCPETHYANGEKRYCLKKRVTFLSYDDPLGKGITLLSI
GFSTLTALFIWVFVDHRGTPIIKANNRSLSYILLITLILCFLCPLLFIGLPNTAMCIMQQ
YIFGLLFTVALSTVLAKTITVVMAFKITAPGRKIRWLLTSQVPKFVIPVCTLIQILLSGI
WLGTSPPFIDKDCHSEHGHIIILCSKGSYIYFYCTLAYLGVMAFGSYLLAFLSRRLPDRF
NESKSLAFSMLVFCSVWVMFLPVYHSTSGKVMVAMEIFSTLASSASILIIVFAPKCYIVL
FRPEVNTLTHNRDKRQHRSKILL
Download sequence
Identical sequences E9Q1L0
NP_001096838.1.92730 ENSMUSP00000132299 ENSMUSP00000132299 ENSMUSP00000132299

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]