SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000132457 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000132457
Domain Number 1 Region: 54-490
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.08e-98
Family L-arabinose binding protein-like 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000132457
Domain Number - Region: 515-562
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00965
Family TNF receptor-like 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000132457   Gene: ENSMUSG00000091651   Transcript: ENSMUST00000170402
Sequence length 855
Comment pep:known chromosome:NCBIM37:7:7829364:7855182:-1 gene:ENSMUSG00000091651 transcript:ENSMUST00000170402
Sequence
RKKMFIFMGVFFLLNITLLMANFIDPRCFWRINLDEITDEYLGLTCAFILAAVQTPTEKD
YFNKTLNFLKTTTNHKYALALVFAMDEINRNPDLLPNMSLIIRYALGHCDGKTVTPTPYL
FHKKKKSPIPNYFCNEESMCSFLISGPNWKVSLSFWKYLDSFLSPRIFQLTYGPFSSIFS
DDEQYPYLYQMAPKDTSLALAMVSFIHYFNWNWIGLVIPDDDQGNQFLLELKKQSENKEI
CFAFVKMISVDDVSFPQNTEMYYNQIVMSSTNVIIIYGETYNFIDLIFRMWEPPILQRIW
ITTKQLNFPTRKKDISHGTFYGSLTFLPHHGEISGFKNFVQTWFHFRNTDLYLVMPEWKY
FNYEDSASNCKILKNNSSDASFDWLMEQKFDMTFSESSHNIYNAVHAIAHALHEMNLQKA
DNQAIDNGKRASSHCLKVNSFLRRAYFTNPLGDKVFMNQRVIMQDEYDIIHFWNLSQHLG
IKMKLGKFSPYLPHGRHSHLYVDMIELATGRRKMPSSVCSADCSPGFRRLWKEGMAACCF
VCSPCPENEISNETNMDQCMNCPEYQYANTEQNKCIQKGVTFLSYEDPLGMALALMAFCF
SAFTAVVLCVFVKHHDTPIVKANNRSLSYLLLMSLMFCFLCSFFFIGLPNRAICVLQQIT
FGIVFTVAVSTVLAKTVTVVLAFKVTDPGRRLRNFLVSGTPNYIIPICSLLQCVLCAIWL
AVSPPFVDIDEHTLHGHIIIVCNKGSDTAFYCILGYLACLALGSFSLAFLAKNLPDTFNE
AKFLTFSMLVFCSVWVTFLPVYHSTKGKHMVAVEIFSILASSAGILGCIFVPKIYIILML
PERNSTQKIREKSYF
Download sequence
Identical sequences ENSMUSP00000131780 ENSMUSP00000132457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]