SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000132467 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000132467
Domain Number 1 Region: 51-490
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.58e-101
Family L-arabinose binding protein-like 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000132467
Domain Number - Region: 607-814
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.00523
Family Calcium ATPase, transmembrane domain M 0.019
Further Details:      
 
Domain Number - Region: 512-559
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00848
Family TNF receptor-like 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000132467   Gene: ENSMUSG00000091178   Transcript: ENSMUST00000166499
Sequence length 861
Comment pep:known chromosome:NCBIM37:7:9744080:9759858:1 gene:ENSMUSG00000091178 transcript:ENSMUST00000166499
Sequence
MFTLMGVFFFLNIPLFMANFIDPRCFWRINLNEIQDEYLGLTCAFILAAVQKPIEKDYFN
KTLNFLKTTKNHKYALALAFAMDEINRNPDLLPNMSLIIRYTLGRCDGKTVIPTPYLFHK
KKQSPIPNYFCNEETMCSFLLTGPNWGVSISFWKYLDSFLSPRILQLTYGPFSSIFSDDE
QYPYLYQMAPKDTSLALAMVSFILYFNWNWIGLVIPDDDQGNQFLLELKKQRENKEICFA
FVKMISVDDISFEHKTEMYYKQIVMSSSNVIIIYEETIDFIDLIFRMWEPPVLQRIWITT
KQWNFPTSKRDITHGTFYGSLTFLPHHGGISGFKDFVQTWFHLKSKDLYLVMPEWKYFKY
ESSASKCKILKNNSSDASFDWLMEQKFDMAFSESSHNIYNAVHAIAHALHEMNLQQVDNQ
AIDNGKGASSHCLKVNSFLRKIHFTNPLGDKVIMKQRVIMQEEYDIFHFGNLSQHLGIKV
KLGKFSPYFSHGRNFHLYVDMLEVATGSRKMPSSVCSAECSPGFRRLWKDGMAACCFVCS
PCPENEISNETNMDKCVNCPEYQYANTEQNKCIQKGVTFLSYEDPLGMALALMAFCFSAF
TAVVLCVFVKHHDTPIVKANNRILSYLLLISLMSCFLCSFFYIGHPNRATCVLQQITFGI
VFTVAVSTVLAKTVTVVLAFKVTDPGRRLRNFLVSGTPNYIIPICSLFQCVLCAIWLEVS
PPFVDIDEHSQHGHIIIVCNKGSVTAFYCVLGYLACLALGSFTLAFLAKNLPDAFNEAKF
LTFSMLVFFSVWVTFLPVYHSTKGKVMVAVEIFSILASSAGMLGCIFAPKIYIILMRPER
NSTQKIKVRNSTQKIKEKSYF
Download sequence
Identical sequences L7N2E1
ENSMUSP00000132467 NP_001098544.1.92730 ENSMUSP00000132467 ENSMUSP00000132467

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]