SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000132478 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000132478
Domain Number 1 Region: 51-498
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 9.42e-107
Family L-arabinose binding protein-like 0.0031
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000132478
Domain Number - Region: 507-553
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0377
Family TNF receptor-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000132478   Gene: ENSMUSG00000090362   Transcript: ENSMUST00000164462
Sequence length 851
Comment pep:known chromosome:NCBIM37:7:94144975:94186478:1 gene:ENSMUSG00000090362 transcript:ENSMUST00000164462
Sequence
MFSLTFVFLVLKLSFLFCYLSDPRCFWRIKDRENYLGDKEADCFFSMYTKHGYVKNDYFS
ENLDKKVTLKTIHLISSVYFAAEEINRNSYILPNTSLIVKIECNLIADNVKRIWSLKKKE
IIPNYYCKNQRRYLIVLTGPIWITSYILGPFLYFSQTPELYCGHFHLLLNDQEQFPHLYQ
MTPKDTSLPQGMVSLAVHFRWNWVGVIITDDDHGIQFLSELRAGMESNTVCLAFVTIITY
NRKLYLKMYHKYYHQITMSSAKVVIVYGDKESPLQFNFILWKSENIQRLWVSVSQFDIIT
MIGEFMLNSVHGTLIFSHQQSEMSGFKQFMQTVHPSNYSNDISLAKLWWTYFKCSLPPPD
CKTLKNCPTKTLLKRFFVPPLGMSMSETCYNLYNSVYAVAHSLHEMLLQQVDTCSENDGK
VLEFNSWKMFSFLKTIQFVNPVGDLINMNQNRERDTEYDIFYIMDFLKHEGLKMKIGRFS
GHFPNGQQLFISDEMIEWATDIKQTIASACSVPCRPGLRKYFQEGKAVCCFDCYPCPENE
ISNMTDMDQCLKCPEDEYANTDQTNCLKKVVTFLDYKEPLGMALTGLAVLFSSLTVVVLC
VFLKHRDTPIVKANNETLSYVLLISLIFCFICSLLYIGYPSMVSCILQQTTFAMVFTVSA
SCVLAKTITVVLAFKITVPGRRLRWLLLSGAPNYIIPICTTIQMMLCGIWLGISPPFVDA
DLHMVHGHIIIVCNKGSVIAFYCVLGYMGSLALASFTVAFLARNLPDTFNEAKLLTFSML
VFCSVWITFLPVYHSTKGKAMVAVEVFCILASSAGMLLCIFVPKCYLILWRPQINSFHEF
RKMHVKNKNIN
Download sequence
Identical sequences E9Q067
NP_001098660.1.92730 ENSMUSP00000132478 ENSMUSP00000132478 ENSMUSP00000132478

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]