SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000132726 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000132726
Domain Number 1 Region: 44-498
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 6.59e-98
Family L-arabinose binding protein-like 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000132726
Domain Number - Region: 507-553
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00188
Family TNF receptor-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000132726   Gene: ENSMUSG00000091006   Transcript: ENSMUST00000171213
Sequence length 850
Comment pep:known chromosome:NCBIM37:7:92554886:92564186:-1 gene:ENSMUSG00000091006 transcript:ENSMUST00000171213
Sequence
MFSLISVIWFLKIKLMFCHLSDPSCFWRIKETENDLGDTETYCLFSISTKQGYVKNDYFS
WNIDKKVTPKTNHLIFSVYLALEEVNKNCHILPNISLLVNIECNGRKYDEKTGLALKIEN
IIPNYSCTNERTYLIVLTAPIWAVSTKLGPFLFMSRIPELYCGHFHPLLSDNEEFPHLYQ
ISPKDTSLPLAMVSLVVHFRWNWIGVIVTSDDQGIQFLSELKGEMQKNIVCLSVAIIIQT
EMSMALKELSMNYKHISISSAKVVIVYGDKFSPINYALTLWISQGILRIWVSVSQFDMIT
ILGDFLLYSSTGTFIFSHQQPEIPGFEKFIQTVYPSNYSSEFSFAKLWWTYFRCSLPPSN
CKKLKNCPTKTIFTWLFRTPFGMAMSDTCYNSYNAIYAVAHSLHEMLMQEVDTWSNNAGK
ELEFDSWKMFSILKTLKFVNPAGDLVNMNQNLKQATQYNIFYVMDFQKDYGLKMKIGRFS
EHLPSGQQLYMSKEMIEWATDIDQILPSICSMPCTPGLRKSPQEGKDICCFVCIPCPENE
ISNMTNMDQCVKCLEDQYANEDHTLCLQKVVAILDYRDPLGKALAGFALCFSLLTSVVLF
VFLKHRDTPIVKANNQTLSIVLLISLIFCFICSLLYIGHPTMVICILQQTTFAIAFTVAT
STILAKTITVVLAFKITVPGRRMRWLLVSGAPKYIILICTMIQLILCGIWLGTSPPFVDA
DVQMVHGHIIIVCNKGSVIAFYCVLGYMGSVALAGFTVAFLARNLPDTFNEAKLLTFSML
VFCSVWMTFIPVYHSTKGKTMVAVEVFCILASSAGLLLCIFAPKCYFILRPQTNSFHKFR
KPHAKTENKS
Download sequence
Identical sequences G3XA45
NP_001098652.1.92730 ENSMUSP00000132726 ENSMUSP00000132726 ENSMUSP00000132726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]