SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000132834 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000132834
Domain Number 1 Region: 2-419
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 7.74e-100
Family L-arabinose binding protein-like 0.0000365
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000132834   Gene: ENSMUSG00000091045   Transcript: ENSMUST00000167771
Sequence length 469
Comment pep:known chromosome:NCBIM37:7:13250812:13270340:-1 gene:ENSMUSG00000091045 transcript:ENSMUST00000167771
Sequence
MWGYRVAQSFVFAIEEINRSAHLLPNLTLGFSIRNSGDSVHGALYETMGFLTGQEEPIPN
YTCQHGSPQAALVGDTRSSLSVSMARLLGLYKFSQVSYSSSLPSLSDKIQFPSFLRTLTS
DITSSHAVTQLIIHFQWSWVIILAQDDDFGQQASSLATQQLSPAGVCIEYHLHVPSHQSL
GKIEETVQKMQKCTSKVVLVFLSNSNFQLILHGLLGVPVSGQVWVSKGTLHMALALTIPG
ISQVLQGTFGLLYHSSRAIGFPEFLAHLRPSQTPEDMFIKKFWEFTFDCTWPYQNSTVTE
GVQFCTGNESLKNKPHPFPEVSKIDAAYTAVYSIAHALHNMLACEHQERKGTNSHNFHSW
QLLHALKKVHFKTLDGIKIMFDANGDLVTKFDIFQGQKTPAGVFHLVHVGMIDPQVSSGN
KMMVQLKEDLQVSSLNAEKTVVLESSPSKDNNRKKPIQGRKPCPRKSKK
Download sequence
Identical sequences E9PXC1
ENSMUSP00000132834 ENSMUSP00000132834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]