SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000133218 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000133218
Domain Number 1 Region: 65-512
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 5.05e-104
Family L-arabinose binding protein-like 0.002
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000133218
Domain Number - Region: 520-568
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00706
Family TNF receptor-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000133218   Gene: ENSMUSG00000091450   Transcript: ENSMUST00000164875
Sequence length 861
Comment pep:known chromosome:NCBIM37:5:109475892:109488471:-1 gene:ENSMUSG00000091450 transcript:ENSMUST00000164875
Sequence
MKKLRTFTISFWLLKFSLILCHVTEPICFWRIKNNKDNDGDLRSDCNYFLWTFEETTEIN
FYNIVDFRIPTRRYEFFLVLFFATDEINKNPDLLPNISLIFWLFGGQCEDEWGVLDTNYS
QNNINVKFINYDCLSPNCYIDLTGPSWKTSLKLPNILTIIVLMWMSHPLFYILQVFFGSF
NPNLSDHDQFPYVHQVATKDTLLSHAMVSLMLHFRWTWIGMVISDDDQGIQFLSDLREEM
QRHGICLAFVNMIPENMQIYMTRAKIYDKQIMESTAKVAIIYGEMNSSLEVSFRRWEDLG
VRRIWITTSQWDVITNKNDFSLDFFHGTVTFEHHHSEIAKFKNFMQTINTDKYPVNISES
ILGWNYFNCSTSMNSYSKMDHLTFNNTSEWTALHKYDMALSEEGYNLYNAVYAVAHTYHE
LILLQVESQQMAVPKGTFTDCQQVSSMLKSRIFTNPVGELVNMKHRENQCADYDIFIIWN
FSQGLGLKVKIGSYLHCYPRSQQLHISEDLEWVTGGSSVPSSMCSMTCTAGFRKIHQNET
ADCCFDCVQCPENEVSNETADMEQCVRCPDDKYANLEKTHCLQRAVSFLAYEDPLGIALG
CMALFLSALTVLVLVTFVKYKDTPIVKANNRILSYILLISLVFCFLCSLLFIGHPNQATC
ILQQTTFGVFFTVAISTVLAKTITVLMAFKLTTPGRRMRGMLASGAPNLVIPICTLIQLV
FCGIWLVTSPPFIDRDTQSEYGKTIIICNKGSVIAFHFVLGYLGSLALGSFTVAFLARNL
PDRFNEAKFLTFSMLVFCSVWITFLPVYHSTRGTVMVVVEVFSILASSAGLLGCIFLPKC
CVILVRLDSNFLQKYEHKLPS
Download sequence
Identical sequences E9Q4X4
ENSMUSP00000133218 ENSMUSP00000133218 ENSMUSP00000133218 NP_001098092.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]