SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000032175 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000032175
Domain Number 1 Region: 413-901
Classification Level Classification E-value
Superfamily ALDH-like 1.57e-164
Family ALDH-like 0.000000000793
Further Details:      
 
Domain Number 2 Region: 1-201
Classification Level Classification E-value
Superfamily Formyltransferase 3.53e-52
Family Formyltransferase 0.00000000277
Further Details:      
 
Domain Number 3 Region: 205-306
Classification Level Classification E-value
Superfamily FMT C-terminal domain-like 3.92e-27
Family Post formyltransferase domain 0.00000114
Further Details:      
 
Domain Number 4 Region: 325-410
Classification Level Classification E-value
Superfamily ACP-like 0.00000345
Family Acyl-carrier protein (ACP) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000032175   Gene: ENSMUSG00000030088   Transcript: ENSMUST00000032175
Sequence length 902
Comment pep:known chromosome:NCBIM37:6:90500799:90549154:1 gene:ENSMUSG00000030088 transcript:ENSMUST00000032175
Sequence
MKIAVIGQSLFGQEVYCQLRKEGHEVVGVFTIPDKDGKADPLGLEAEKDGVPVFKFPRWR
ARGQALPEVVAKYQALGAELNVLPFCSQFIPMEVINAPRHGSIIYHPSLLPRHRGASAIN
WTLIHGDKKGGFTIFWADDGLDTGDLLLQKECDVLPDDTVSTLYNRFLFPEGIKGMVQAV
RLIAEGTAPRRPQPEEGATYEGIQKKETAMINWDQPAEAIHNWIRGNDKVPGAWTEACGQ
KLTFFNSTLNTSGLVAQGEALPIPGAHRPGLVTKAGLILFGNDDRMLLVKNIQLEDGKMM
PASQFFKGSASSALELTEEELATAEAVRSSWMRILPNVPEVEDSTDFFKSGAASVDVVRL
VEEVKELCDGLELENEDVYMATTFGDFIQLLVRKLRGEDGESECVINYVEKAVKKLTLQM
PYQLFIGGEFVDAEGAKTYSTINPTDGSVICQVSLAQVSDVDKAVAAAKEAFENGLWGKI
NARDRGRLLYRLADLMEQHQEELATIEALDAGAVYTLALKTHVGMSIQTFRYFAGWCDKI
QGATIPINQARPNRNLTLTKKEPVGVCGIVIPWNYPLMMLSWKTAACLAAGNTVVIKPAQ
VTPLTALKFAELTLKAGIPKGVVNILPGSGSLVGQRLSDHPDVRKIGFTGSTEVGKHIMK
SCALSNVKKVSLELGGKSPLIIFADCDLNKAVQMGMSSVFFNKGENCIAAGRLFVEDSIH
DQFVQKVVEEVGKMKIGNPLDRDTNHGPQNHEAHLRKLVEYCQRGVKEGATLVCGGNQVP
RPGFFFQPTVFTDVEDHMYIAKEESFGPIMIISRFADGDVDAVLSRANATEFGLASGVFT
RDINKALYVSDKLQAGTVFVNTYNKTDVAAPFGGFKQSGFGKDLGEAALNEYLRIKTVTF
EY
Download sequence
Identical sequences Q8R0Y6
ENSMUSP00000032175 10090.ENSMUSP00000032175 ENSMUSP00000032175 ENSMUSP00000114304 ENSMUSP00000032175 NP_081682.1.92730 XP_006505342.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]