SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000034597 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000034597
Domain Number 1 Region: 295-540
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.62e-89
Family Eukaryotic proteases 0.0000288
Further Details:      
 
Domain Number 2 Region: 205-301
Classification Level Classification E-value
Superfamily SRCR-like 1.01e-19
Family Hepsin, N-terminal domain 0.049
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000034597
Domain Number - Region: 185-208
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000249
Family LDL receptor-like module 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000034597   Gene: ENSMUSG00000037129   Transcript: ENSMUST00000034597
Sequence length 548
Comment pep:known chromosome:NCBIM37:9:45127183:45155664:1 gene:ENSMUSG00000037129 transcript:ENSMUST00000034597
Sequence
MDRGSHRNSSPARTPPQASPARTSPARAPPQASPARTPPQASPTRTPPQASPARAPPPQA
SPARASPARASLARAPPSRSSSGRSSSARSASTTSSPTRVYLVRATPVGAVPIRASPARS
APATRATRESPGLSFPKFSWQETQRQLPLIGCVILLISLVISLILLFYFWRGHTGIKYKE
PLESCPIHAVRCDGVVDCKMKSDELGCVRFDWDKSLLKVYSGSSGEWLPVCSSSWNDTDS
KRTCQQLGFDSAYRTTEVAHRDITSSFLLSEYNTTIQESLYRSQCPSRRYVSLQCSHCGL
RAMTGRIVGGALTSESKWPWQVSLHFGTTHICGGTLIDAQWVLTAAHCFFVTREKLLEGW
KVYAGTSNLHQLPEAASISQIIINGNYTDEQDDYDIALIRLSKPLTLSAHIHPACLPMHG
QTFGLNETCWITGFGKTKETDEKTSPFLREVQVNLIDFKKCNDYLVYDSYLTPRMMCAGD
LRGGRDSCQGDSGGPLVCEQNNRWYLAGVTSWGTGCGQKNKPGVYTKVTEVLPWIYRKME
SEVRFRKS
Download sequence
Identical sequences E9QPR6
ENSMUSP00000034597 10090.ENSMUSP00000034597 ENSMUSP00000034597 ENSMUSP00000034597 NP_001013391.2.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]