SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000038149 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000038149
Domain Number 1 Region: 172-433
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.62e-87
Family Eukaryotic proteases 0.0000000224
Further Details:      
 
Domain Number 2 Region: 79-185
Classification Level Classification E-value
Superfamily SRCR-like 6.93e-16
Family Hepsin, N-terminal domain 0.00000439
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000038149   Gene: ENSMUSG00000001249   Transcript: ENSMUST00000039435
Sequence length 445
Comment pep:novel chromosome:NCBIM37:7:31883744:31896016:-1 gene:ENSMUSG00000001249 transcript:ENSMUST00000039435
Sequence
MWVGARDDAGHMADEEPGAHRGGSTCSRPQPGKGGRTAACCSRPKVAALIVGTLLFLTGI
GAASWAIVTILLQSDQEPLYQVQLSPGDSRLAVFDKTEGTWRLLCSSRSNARVAGLGCEE
MGFLRALAHSELDVRTAGANGTSGFFCVDEGGLPLAQRLLDVISVCDCPRGRFLTATCQD
CGRRKLPVDRIVGGQDSSLGRWPWQVSLRYDGTHLCGGSLLSGDWVLTAAHCFPERNRVL
SRWRVFAGAVARTSPHAVQLGVQAVIYHGGYLPFRDPTIDENSNDIALVHLSSSLPLTEY
IQPVCLPAAGQALVDGKVCTVTGWGNTQFYGQQAMVLQEARVPIISNEVCNSPDFYGNQI
KPKMFCAGYPEGGIDACQGDSGGPFVCEDSISGTSRWRLCGIVSWGTGCALARKPGVYTK
VTDFREWIFKAIKTHSEASGMVTQP
Download sequence
Identical sequences E9Q5P0
ENSMUSP00000038149 ENSMUSP00000103737 NP_001263198.1.92730 10090.ENSMUSP00000038149 ENSMUSP00000038149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]