SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000101194 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000101194
Domain Number 1 Region: 357-620
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 1.44e-60
Family Galactose oxidase, central domain 0.005
Further Details:      
 
Domain Number 2 Region: 68-185
Classification Level Classification E-value
Superfamily POZ domain 3.77e-35
Family BTB/POZ domain 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000101194   Gene: ENSMUSG00000078484   Transcript: ENSMUST00000105569
Sequence length 640
Comment pep:known chromosome:NCBIM37:4:155603153:155608966:-1 gene:ENSMUSG00000078484 transcript:ENSMUST00000105569
Sequence
MQPRGERPAGRTQSPEHSSPGPGPEAPPPPQPPAPEAERARPRQARPAAPMEGAMQLLSR
EGHSVAHNSKRHYHDAFVAMSRMRQRGLLCDIVLHVAAKEIRAHKVVLASCSPYFHAMFT
NEMSESRQTHVTLHDIDPQALDQLVQFAYTAEIVVGEGNVQTLLPAASLLQLNGVRDACC
KFLLSQLDPSNCLGIRGFADTHSCSDLLKAAHRYVLQHFVDVAKTEEFMLLPLKQVLELV
SSDSLNVPSEEDVYRAVLSWVKHDVDTRRQHVPRLMKCVRLPLLSRDFLLGHVDAESLVR
HHPDCKDLLIEALKFHLLPEQRGVLGTSRTRPRRCEGAGPVLFAVGGGSLFAIHGDCEAY
DTRTDRWHVVASMSTRRARVGVAAVGNRLYAVGGYDGTSDLATVESYDPVTNTWQPEVSM
GTRRSCLGVAALHGLLYAAGGYDGASCLNSAERYDPLTGTWTSIAAMSTRRRYVRVATLD
GNLYAVGGYDSSSHLATVEKYEPQVNSWTPVASMLSRRSSAGVAVLEGALYVAGGNDGTS
CLNSVERYSTKAGAWESVAPMNIRRSTHDLVAMDGWLYAVGGNDGSSSLNSIEKYNPRTN
KWVAASCMFTRRSSVGVAVLELLNFPPPSSPTLSVSSTSL
Download sequence
Identical sequences B2RTE7 Q6TDP3 Q8K430
ENSMUSP00000101194 ENSMUSP00000101194 10090.ENSMUSP00000101194 10116.ENSRNOP00000027547 ENSRNOP00000027547 ENSMUSP00000101194 NP_663704.1.100692 NP_663704.1.4139 NP_938047.1.92730 XP_021055464.1.100879 ENSRNOP00000027547

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]