SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000105000 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000105000
Domain Number 1 Region: 534-662
Classification Level Classification E-value
Superfamily PH domain-like 3.59e-16
Family Pleckstrin-homology domain (PH domain) 0.021
Further Details:      
 
Domain Number 2 Region: 87-252
Classification Level Classification E-value
Superfamily ARM repeat 0.00000633
Family HspBP1 domain 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000105000   Gene: ENSMUSG00000014791   Transcript: ENSMUST00000109375
Sequence length 720
Comment pep:known chromosome:NCBIM37:8:107829501:107834523:1 gene:ENSMUSG00000014791 transcript:ENSMUST00000109375
Sequence
MAPPRNVVKIAVQMSDAIPQLIQLDQAKPLATVLKEVCDAWSLTHPEHYALQFADGHRKY
ITENNRLEIKNGSILCLSTAPDLKAQQLLGRLQNTSREGCCEVLRNLVLLASDMTFAQEV
ISRDGLQKLSTIIENGDDLGEMLALGLRAFLELMEHGVVSWETLSISFVRKVISYVNMNL
MDASVQPLALRLLESVTLSSPALGQLVKSEVPLDRLLVHLQVMNHQLQTKAMALLTALLQ
GASPTERKEMLDHLWKKNLRQFIYKNIIHSATPMGDEMAHHLYVLQALTLGLLEPRMRTP
LDPYSQEQRDQLQALRQAAFEPEGESLGTGLSADRRRSLCVREFRKLGFSNSNPAQDLER
VPPGLLALDNMLYFSRHAPSAYSRFVLENSSREDKHECPFARSSIQLTALLCELLRVGEP
CSETAQDFSPMFFSQDHSFHELFCVAIQLLNKTWKEMRATQEDFDKVMQVVREQLARTLA
LKPTSLELFRTKVNALTYGEVLRLRQTERLHQEGTLAPPILELREKLKPELMGLIRQQRL
LRLCEGMLFRKISSRRRQDKLWFCCLSPNHKVLQYGDVEEGAKPPTLESLPEQLPVADIR
ALLMGKDCPHVREKGSGKQNKDLYELAFSISYDHGEEEAYLNFIAPSKRDFYLWTDGLSA
LLGSTMGSELTRLDLEQLLTMETKLRLLELENVPIPEQPPPVPPPPTNFNFCYDYSITEP
Download sequence
Identical sequences Q8BYZ7
NP_766348.3.92730 10090.ENSMUSP00000105000 ENSMUSP00000105000 ENSMUSP00000105000 ENSMUSP00000105000

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]