SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000125677 from Mus musculus 63_37 (longest transcript per gene)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000125677
Domain Number 1 Region: 958-1101,1156-1220
Classification Level Classification E-value
Superfamily Hemopexin-like domain 2.49e-40
Family Hemopexin-like domain 0.00085
Further Details:      
 
Domain Number 2 Region: 68-108
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000248
Family Somatomedin B domain 0.0011
Further Details:      
 
Domain Number 3 Region: 27-67
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000107
Family Somatomedin B domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000125677   Gene: ENSMUSG00000006014   Transcript: ENSMUST00000161611
Sequence length 1221
Comment pep:known chromosome:NCBIM37:1:152296999:152313295:-1 gene:ENSMUSG00000006014 transcript:ENSMUST00000161611
Sequence
MGWKILPVCLSLLLPVVLIQQVSSQDLSSCAGRCGEGYSRDATCNCDYNCQHYMECCPDF
KRVCTTELSCKGRCFESFARGRECDCDSQCKQYGKCCADYDSFCEEVHNPTSPSPKTAPP
PPGASHTIKSTTKRSPKSPKKKTKKVVESEEITEEHSVSENQESSSSSSSSSSTIRKIKS
SKNSANRELQKNPKVKDNKKNTPKKKPNPEPPAVDEAGSGLDNGEFKLTPPPPDPPTTPH
SKVTTSPKTTAAKPVTPKPSLAPNSETSKEASLASNKETTVETKETTATNKQSSASKKKT
TSAKETRSAEKTSDKDVEPTSTTPKNSAPTTTKKPVTTTKEPVPTTPKEPEPTTPKEPPP
TTKKPEPTTPKEPEPTTPKEPEPTTPKEPEPTTPKEPEPTTPKEPPPTTKKPEPTTPKEP
EPTTPKEPEPTTTKEPEPTTTKEPESTTRKEPEPTTPKEPEPTTPKEPEPTTPKEPEPTT
PKEPEPTTLKEPEPTTPKEPEPTTPKEPEPTTPKEPEPTTPKEPEPTTPKEPEPTTPKEP
EPTTPKEPEPTTPKEPEPTTPKEPEPTTPKEPEPTTPKEPEPTTLKEPEPTTPKEPEPTT
PKEPEPTTLKEPEPTTPKEPEPTTLKEPEPTTPKEPEPTTTKEPESTTRKEPEPTTPKEP
EPTTPKEPEPTTPKEPEPTTPKEPEPTTPKEPEPTTPKEPEPTTPKEPEPTTPKKPEPTT
PKEPEPTTPKEPEPTTPKEPEPTTPKEPEPTTRKEPEPTTPKEPEPTTPKEPEPTTPKKP
EPTTTSPKTTTLKATTLAPKVTAPAEEIQNKPEETTPASEDSDDSKTTLKPQKPTKAPKP
TKKPTKAPKKPTSTKKPKTPKTRKPKTTPSPLKTTSATPELNTTPLEVMLPTTTIPKQTP
NPETAEVNPDHEDADGGEGEKPLIPGPPVLFPTAIPGTDLLAGRLNQGININPMLSDETN
LCNGKPVDGLTTLRNGTLVAFRGHYFWMLNPFRPPSPPRRITEVWGIPSPIDTVFTRCNC
EGKTFFFKDSQYWRFTNDVVDPGYPKQIVKGFGGLTGKIVAALSIAKYKDRPESVYFFKR
GGNIQQYTYKQEPMKKCTGRRPAINYSVYGEAAQVRRRRFERAVGPFQTHTFRIHYSVPM
RVSYQDKGFLHNEVKVSTMWRGFPNVVTSAITLPNIRKPDGYDYYAFSKDQYYNIDVPTR
TARAITTRSGQTLSKIWYNCP
Download sequence
Identical sequences E0CZ58
NP_067375.3.92730 ENSMUSP00000125677 ENSMUSP00000125677 ENSMUSP00000128943 ENSMUSP00000107532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]