SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|557622068|ref|YP_008783199.1| from Bacillus toyonensis BCT-7112

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|557622068|ref|YP_008783199.1|
Domain Number 1 Region: 91-369
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.32e-65
Family RecA protein-like (ATPase-domain) 0.000000048
Further Details:      
 
Domain Number 2 Region: 4-49
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.0000000000589
Family Rho termination factor, N-terminal domain 0.015
Further Details:      
 
Domain Number 3 Region: 50-114
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000331
Family Cold shock DNA-binding domain-like 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|557622068|ref|YP_008783199.1|
Sequence length 423
Comment Transcription termination factor Rho [Bacillus toyonensis BCT-7112]
Sequence
MNLSIAALENMKLKELYELAKEFKISYYSKLTKKELIFAILKARAEKEGFFFMEGVLEII
QSEGFGFLRPINYSPSSEDIYISASQIRRFDLRNGDKVSGKVRPPKENERYFGLLQVEAV
NGDDPESAKERVHFPALTPLYPDRQMKLETEPKKLPTRIMDLIAPVGFGQRGLIVAPPKA
GKTSLLKEIAHSVTTNHPEAELIVLLIDERPEEVTDIERSVKGDVVSSTFDEVPENHIKV
AELVLERAMRLVEHKKDVIILMDSITRLARAYNLVIPPSGRTLSGGIDPAAFHRPKRFFG
AARNIEEGGSLTILATALVDTGSRMDDVIYEEFKGTGNMELHLDRSLAERRIFPAIDIRR
SGTRKEDLLIPKEHLDKLWGIRKTMRDTPDFVEGFLRKLRQTKTNEEFLQNIVADSKRYV
TTK
Download sequence
Identical sequences A0A0F5RTR5 A0A0G8CAG8 A0A0M0MJ80 A0A0T8VV66 A0A1A9PPH4 A0A1J9TJE6 A0A1J9YNW3 A0A1J9Z1B0 A0A1J9ZM34 A0A1V6LGT4 A0A229M7F1 A0A242WJA8 A0A242WXV7 A0A242XGT1 A0A243HYM9 A0A243IL49 A0A243MTJ5 A0A243NPJ1 A0A2A7DFL9 A0A2A7E8B2 A0A2A8UYD0 A0A2B4ENN0 A0A2B4NVQ4 A0A2B8UNE3 A0A2D0AV38 A0A2K1RZ74 B7HY92 B9IRW4 C2MTM4 C2PN70 C2SC06 C2V3F6 C2VJU4 C2X4C5 C2YZH0 F0PV80 J8FMP8 J8GQF6 J8K476 J9A7M5 K0G1N4 Q72XB8 R8L4N3
WP_001053898.1.100095 WP_001053898.1.100241 WP_001053898.1.100684 WP_001053898.1.10069 WP_001053898.1.100771 WP_001053898.1.100873 WP_001053898.1.101140 WP_001053898.1.101309 WP_001053898.1.101550 WP_001053898.1.101843 WP_001053898.1.10762 WP_001053898.1.11044 WP_001053898.1.11060 WP_001053898.1.11380 WP_001053898.1.12751 WP_001053898.1.13024 WP_001053898.1.13113 WP_001053898.1.13299 WP_001053898.1.13424 WP_001053898.1.14084 WP_001053898.1.15502 WP_001053898.1.16199 WP_001053898.1.17265 WP_001053898.1.17408 WP_001053898.1.17899 WP_001053898.1.17927 WP_001053898.1.1809 WP_001053898.1.1850 WP_001053898.1.18840 WP_001053898.1.1907 WP_001053898.1.19173 WP_001053898.1.20687 WP_001053898.1.21172 WP_001053898.1.21643 WP_001053898.1.22991 WP_001053898.1.23100 WP_001053898.1.23110 WP_001053898.1.23427 WP_001053898.1.2407 WP_001053898.1.24184 WP_001053898.1.24338 WP_001053898.1.24377 WP_001053898.1.24709 WP_001053898.1.24759 WP_001053898.1.24792 WP_001053898.1.24969 WP_001053898.1.24992 WP_001053898.1.25757 WP_001053898.1.26450 WP_001053898.1.26499 WP_001053898.1.26847 WP_001053898.1.27140 WP_001053898.1.27334 WP_001053898.1.29209 WP_001053898.1.29766 WP_001053898.1.30144 WP_001053898.1.30788 WP_001053898.1.3130 WP_001053898.1.31387 WP_001053898.1.31685 WP_001053898.1.3196 WP_001053898.1.32522 WP_001053898.1.33045 WP_001053898.1.33061 WP_001053898.1.3318 WP_001053898.1.35153 WP_001053898.1.35255 WP_001053898.1.35518 WP_001053898.1.3561 WP_001053898.1.3615 WP_001053898.1.37027 WP_001053898.1.37093 WP_001053898.1.37384 WP_001053898.1.37626 WP_001053898.1.37661 WP_001053898.1.37990 WP_001053898.1.38425 WP_001053898.1.39001 WP_001053898.1.39538 WP_001053898.1.4039 WP_001053898.1.40839 WP_001053898.1.41976 WP_001053898.1.42165 WP_001053898.1.42182 WP_001053898.1.42237 WP_001053898.1.42747 WP_001053898.1.42941 WP_001053898.1.43533 WP_001053898.1.43762 WP_001053898.1.44449 WP_001053898.1.44463 WP_001053898.1.4453 WP_001053898.1.45089 WP_001053898.1.46244 WP_001053898.1.46349 WP_001053898.1.46524 WP_001053898.1.46586 WP_001053898.1.46746 WP_001053898.1.46864 WP_001053898.1.47095 WP_001053898.1.47097 WP_001053898.1.474 WP_001053898.1.47441 WP_001053898.1.48010 WP_001053898.1.48164 WP_001053898.1.48311 WP_001053898.1.48599 WP_001053898.1.49056 WP_001053898.1.49428 WP_001053898.1.49802 WP_001053898.1.499 WP_001053898.1.50316 WP_001053898.1.50350 WP_001053898.1.50416 WP_001053898.1.50514 WP_001053898.1.50770 WP_001053898.1.51087 WP_001053898.1.51099 WP_001053898.1.51556 WP_001053898.1.51656 WP_001053898.1.52532 WP_001053898.1.52756 WP_001053898.1.52932 WP_001053898.1.54419 WP_001053898.1.54775 WP_001053898.1.54782 WP_001053898.1.55057 WP_001053898.1.55788 WP_001053898.1.55893 WP_001053898.1.56055 WP_001053898.1.5628 WP_001053898.1.56549 WP_001053898.1.57203 WP_001053898.1.57245 WP_001053898.1.57565 WP_001053898.1.57815 WP_001053898.1.57859 WP_001053898.1.58037 WP_001053898.1.58328 WP_001053898.1.58335 WP_001053898.1.5841 WP_001053898.1.58814 WP_001053898.1.59052 WP_001053898.1.59075 WP_001053898.1.59773 WP_001053898.1.60012 WP_001053898.1.60274 WP_001053898.1.60781 WP_001053898.1.61231 WP_001053898.1.61481 WP_001053898.1.61944 WP_001053898.1.62918 WP_001053898.1.64377 WP_001053898.1.64615 WP_001053898.1.64666 WP_001053898.1.64706 WP_001053898.1.64770 WP_001053898.1.65758 WP_001053898.1.65983 WP_001053898.1.66535 WP_001053898.1.66932 WP_001053898.1.6716 WP_001053898.1.67283 WP_001053898.1.6753 WP_001053898.1.69703 WP_001053898.1.69970 WP_001053898.1.70018 WP_001053898.1.70209 WP_001053898.1.70645 WP_001053898.1.71142 WP_001053898.1.71648 WP_001053898.1.72514 WP_001053898.1.72554 WP_001053898.1.74901 WP_001053898.1.75358 WP_001053898.1.75374 WP_001053898.1.75554 WP_001053898.1.76342 WP_001053898.1.77370 WP_001053898.1.77576 WP_001053898.1.77690 WP_001053898.1.77902 WP_001053898.1.77968 WP_001053898.1.78264 WP_001053898.1.79043 WP_001053898.1.79250 WP_001053898.1.79252 WP_001053898.1.79658 WP_001053898.1.79687 WP_001053898.1.80239 WP_001053898.1.80571 WP_001053898.1.80955 WP_001053898.1.80964 WP_001053898.1.81088 WP_001053898.1.81198 WP_001053898.1.82421 WP_001053898.1.82533 WP_001053898.1.82566 WP_001053898.1.82986 WP_001053898.1.83070 WP_001053898.1.83206 WP_001053898.1.83228 WP_001053898.1.8365 WP_001053898.1.84323 WP_001053898.1.84337 WP_001053898.1.8450 WP_001053898.1.86041 WP_001053898.1.86082 WP_001053898.1.8759 WP_001053898.1.87627 WP_001053898.1.87960 WP_001053898.1.8907 WP_001053898.1.8923 WP_001053898.1.89460 WP_001053898.1.89675 WP_001053898.1.89698 WP_001053898.1.89704 WP_001053898.1.90187 WP_001053898.1.90671 WP_001053898.1.91080 WP_001053898.1.91404 WP_001053898.1.91569 WP_001053898.1.92347 WP_001053898.1.92586 WP_001053898.1.93290 WP_001053898.1.93904 WP_001053898.1.93932 WP_001053898.1.94270 WP_001053898.1.95457 WP_001053898.1.95484 WP_001053898.1.95786 WP_001053898.1.96356 WP_001053898.1.97617 WP_001053898.1.98519 WP_001053898.1.99266 gi|375287356|ref|YP_005107795.1| gi|384183197|ref|YP_005568959.1| gi|217962821|ref|YP_002341399.1| gi|407707804|ref|YP_006831389.1| gi|402554576|ref|YP_006595847.1| gi|557622068|ref|YP_008783199.1| gi|222098803|ref|YP_002532861.1| gi|42784505|ref|NP_981752.1| 222523.BCE_5460 361100.BCQ_5172 405534.BCAH187_A5510

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]