SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|557622728|ref|YP_008783860.1| from Bacillus toyonensis BCT-7112

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|557622728|ref|YP_008783860.1|
Domain Number 1 Region: 227-352
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000000262
Family Tetratricopeptide repeat (TPR) 0.0075
Further Details:      
 
Domain Number 2 Region: 7-65
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.000000000011
Family Phage repressors 0.066
Further Details:      
 
Domain Number 3 Region: 153-260
Classification Level Classification E-value
Superfamily TPR-like 0.000000734
Family Tetratricopeptide repeat (TPR) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|557622728|ref|YP_008783860.1|
Sequence length 419
Comment transcriptional regulator/TPR domain protein [Bacillus toyonensis BCT-7112]
Sequence
MQQTLEKIGKQVFYKRLQQKMTQEELCQGICSVSYLSKIENGKIEASEEILQLLCARLEI
AVTDLRDVEEDVKGKLDEWLNALVHLDKQQVERIYEELQGEMKHVLDFEIINYYKLLYTR
YLMMKRDLPAVEEELDGLKKVYKKYSPFQKMLYTYNKALLYSVQYKYTQALEYLLKTESM
AKELGYYETGIYYNLALTYSQMEIDHMTLYFANVALEGFKSEYKFRNIINCKFLIAFSYT
RKKQYNEAMEIYNHIIREATSFADKDNILSIALNNIGYLYYRQKNYAKAKEYYIECLKYK
KEEDMNYIDAMYELSLQCIQLGELEEAAEWIEKGILAARKDERYKGMLYLLLNLRYKYFE
ERDLYKKFLETEVVPFFKTEENIKDLKKVYLELAEYLEECSDFKESNRYYKLAITLLEE
Download sequence
Identical sequences A0A0L1NP27 A0A1D3PTN3 A0A1V6LD26 A0A242WSB1 C2UQQ7 C2V744 K0FXK2 R8M9G9
WP_001187940.1.100771 WP_001187940.1.11380 WP_001187940.1.13113 WP_001187940.1.14084 WP_001187940.1.2407 WP_001187940.1.24792 WP_001187940.1.24969 WP_001187940.1.24992 WP_001187940.1.30144 WP_001187940.1.3196 WP_001187940.1.37661 WP_001187940.1.42182 WP_001187940.1.42941 WP_001187940.1.4453 WP_001187940.1.46586 WP_001187940.1.474 WP_001187940.1.499 WP_001187940.1.52532 WP_001187940.1.54419 WP_001187940.1.55893 WP_001187940.1.5841 WP_001187940.1.64770 WP_001187940.1.66535 WP_001187940.1.70209 WP_001187940.1.75358 WP_001187940.1.75374 WP_001187940.1.77968 WP_001187940.1.84323 WP_001187940.1.86041 WP_001187940.1.89698 WP_001187940.1.93904 WP_001187940.1.94270 gi|557622728|ref|YP_008783860.1| gi|407708560|ref|YP_006832145.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]