SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|42560694|ref|NP_975145.1| from Mycoplasma mycoides subsp. mycoides SC str. PG1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|42560694|ref|NP_975145.1|
Domain Number 1 Region: 37-118
Classification Level Classification E-value
Superfamily TrpR-like 5.23e-16
Family Chromosomal replication initiation factor DnaA C-terminal domain IV 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|42560694|ref|NP_975145.1|
Sequence length 180
Comment IS1296EH transposase protein A [Mycoplasma mycoides subsp. mycoides SC str. PG1]
Sequence
MSKLNLEKKLKIVKEAKKLNIKKSTYLANKYDISVDTVESLVNRFEVFGIEGLINKEKKP
YYSAKLKLKIVLYKLETNHSYDEVAKKFNIIYSSTIAGWVKKYREYGFLGLNNNIGRPKK
IMKNPNKKPAKIKKSQVKINNEQQIKELKEQVEYYKLEAEFWKKFHTLLTKEKSTRKKQK
Download sequence
Identical sequences A0A126SSV3 Q6MU97
NP_975145.1.55851 WP_011166344.1.11018 WP_011166344.1.3214 WP_011166344.1.37196 WP_011166344.1.51345 WP_011166344.1.84266 gi|479184340|ref|YP_007810938.1| gi|42560694|ref|NP_975145.1| 272632.MSC_0141

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]