SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15827961|ref|NP_302224.1| from Mycobacterium leprae TN

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15827961|ref|NP_302224.1|
Domain Number 1 Region: 79-139
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000209
Family NfeD domain-like 0.0047
Further Details:      
 
Weak hits

Sequence:  gi|15827961|ref|NP_302224.1|
Domain Number - Region: 15-69
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0241
Family Glycerol-3-phosphate transporter 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15827961|ref|NP_302224.1|
Sequence length 143
Comment hypothetical protein ML1803 [Mycobacterium leprae TN]
Sequence
MPVALVWLIFALVLACAEALTGDMFLLMLGGGALASAVSGWLTDWPIWVDGTVFLIVSVL
LLTLVRPAVRRLTPALGTQLGIKALEGKAALVLDRVARNEGQVKLDGQVWTARTLSDDDV
YEAGESVIVVHIDGATAMVFRNG
Download sequence
Identical sequences A0A0H3MR63 A0A197SDS5 Q9CBM4
gi|15827961|ref|NP_302224.1| gi|221230438|ref|YP_002503854.1| NP_302224.1.10168 WP_010908545.1.20769 WP_010908545.1.50976 WP_010908545.1.86095 272631.ML1803 561304.MLBr_01803

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]