SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000000161 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000000161
Domain Number 1 Region: 123-336
Classification Level Classification E-value
Superfamily vWA-like 6.82e-55
Family Integrin A (or I) domain 0.0000198
Further Details:      
 
Domain Number 2 Region: 345-423
Classification Level Classification E-value
Superfamily Integrin domains 5.75e-17
Family Integrin domains 0.0014
Further Details:      
 
Domain Number 3 Region: 22-81
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000022
Family Plexin repeat 0.0015
Further Details:      
 
Domain Number 4 Region: 507-547
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000207
Family Integrin beta EGF-like domains 0.0018
Further Details:      
 
Domain Number 5 Region: 551-588
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000257
Family Integrin beta EGF-like domains 0.047
Further Details:      
 
Domain Number 6 Region: 593-665
Classification Level Classification E-value
Superfamily Integrin beta tail domain 0.0000719
Family Integrin beta tail domain 0.008
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000000161
Domain Number - Region: 429-456
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0103
Family Integrin beta EGF-like domains 0.036
Further Details:      
 
Domain Number - Region: 472-507
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0268
Family Integrin beta EGF-like domains 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000000161   Gene: ENSMUSG00000000157   Transcript: ENSMUST00000000161
Sequence length 738
Comment pep:known chromosome:GRCm38:16:96422288:96443619:-1 gene:ENSMUSG00000000157 transcript:ENSMUST00000000161 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGQCTLLPVLAGLLSLESALSQLCTKDNVSTCQDCIRSGPSCAWCQKLNFTGRGEPDSV
RCDTPEQLLLKGCTSEYLVDPKSLAESQEDKERDQRQLSPRNVTVFLRPGQAATFKVDFQ
RTQDNSVDLYFLMGLSGSAQGHLSNVQTLGSDLLKALNEISRSGRIGFGSIVNMTFQHIL
KLTADSSQFQRELRKQLVSGKLATPKGQLDAVVQVAICLGEIGWRNGTRFLVLVTDNDFH
LAKDKTLGTRQNTSDGRCHLDDGMYRSRGEPDYQSVVQLASKLAENNIQPIFVVPSRMVK
TYEKLTTFIPKLTIGELSDDSSNVAQLIRNAYSKLSSIVVLNHSTIPSILKVTYDSYCSN
GTSNPGKPSGDCSGVQINDQVTFQVNITASECFREQFFFIQALGFMDSVTVRVLPLCECQ
CQEQSQHHSLCGGKGAMECGICRCNSGYAGKNCECQTQGPSSQDLEGSCRKDNSSIMCSG
LGDCICGQCECHTSDIPNKEIYGQYCECNNVNCERYDGQVCGGPERGHCSCGRCFCRYGF
VGSACQCRMSTSGCLNNRMVECSGHGRCYCNRCLCDPGYQPPLCEKRPGYFHRCSEYYSC
ARCLKDNSAIKCRECWNLLFSNTPFSNKTCMTERDSEGCWTTYTLYQPDQSDINSIYIKE
SLVCAEISNTTILLGVIVGVLLAVIFLLVYCMVYLKGTQKAAKLPRKGGAQSTLAQQPHF
QEPHHVEPVWNQERQGTQ
Download sequence
Identical sequences Q3UV74
ENSMUSP00000000161 NP_032431.2.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]