SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000000299 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000000299
Domain Number 1 Region: 122-365
Classification Level Classification E-value
Superfamily vWA-like 6.82e-85
Family Integrin A (or I) domain 0.000000343
Further Details:      
 
Domain Number 2 Region: 335-452
Classification Level Classification E-value
Superfamily Integrin domains 2.56e-20
Family Integrin domains 0.0011
Further Details:      
 
Domain Number 3 Region: 625-699
Classification Level Classification E-value
Superfamily Integrin beta tail domain 0.00000000000000103
Family Integrin beta tail domain 0.0023
Further Details:      
 
Domain Number 4 Region: 22-81
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000183
Family Plexin repeat 0.0022
Further Details:      
 
Domain Number 5 Region: 535-575
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000251
Family Integrin beta EGF-like domains 0.0013
Further Details:      
 
Domain Number 6 Region: 579-618
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000012
Family Integrin beta EGF-like domains 0.011
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000000299
Domain Number - Region: 457-484
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00254
Family Integrin beta EGF-like domains 0.033
Further Details:      
 
Domain Number - Region: 500-535
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0151
Family Integrin beta EGF-like domains 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000000299   Gene: ENSMUSG00000000290   Transcript: ENSMUST00000000299
Sequence length 770
Comment pep:novel chromosome:GRCm38:10:77530252:77565686:1 gene:ENSMUSG00000000290 transcript:ENSMUST00000000299 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGPHSLLLALAGLFFLGSAVSQECTKYKVSSCRDCIQSGPGCSWCQKLNFTGPGEPDSL
RCDTRAQLLLKGCPADDIMDPRSIANPEFDQRGQRKQLSPQKVTLYLRPGQAAAFNVTFR
RAKGYPIDLYYLMDLSYSMLDDLNNVKKLGGDLLQALNEITESGRIGFGSFVDKTVLPFV
NTHPEKLRNPCPNKEKACQPPFAFRHVLKLTDNSNQFQTEVGKQLISGNLDAPEGGLDAI
MQVAACPEEIGWRNVTRLLVFATDDGFHFAGDGKLGAILTPNDGRCHLEDNMYKRSNEFD
YPSVGQLAHKLSESNIQPIFAVTKKMVKTYEKLTEIIPKSAVGELSDDSSNVVQLIKNAY
YKLSSRVFLDHSTLPDTLKVTYDSFCSNGASSIGKSRGDCDGVQINNPVTFQVKVMASEC
IQEQSFVIRALGFTDTVTVQVRPQCECQCRDQSREQSLCGGKGVMECGICRCESGYIGKN
CECQTQGRSSQELERNCRKDNSSIVCSGLGDCICGQCVCHTSDVPNKEIFGQYCECDNVN
CERYNSQVCGGSDRGSCNCGKCSCKPGYEGSACQCQRSTTGCLNARLVECSGRGHCQCNR
CICDEGYQPPMCEDCPSCGSHCRDNHTSCAECLKFDKGPFEKNCSVQCAGMTLQTIPLKK
KPCKERDSEGCWITYTLQQKDGRNIYNIHVEDSLECVKGPNVAAIVGGTVVGVVLIGVLL
LVIWKALTHLTDLREYRRFEKEKLKSQWNNDNPLFKSATTTVMNPKFAES
Download sequence
Identical sequences Q542I8
10090.ENSMUSP00000000299 ENSMUSP00000000299 NP_032430.2.92730 ENSMUSP00000000299 ENSMUSP00000000299

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]