SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000000369 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000000369
Domain Number 1 Region: 78-254
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.4e-37
Family G proteins 0.00000216
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000000369   Gene: ENSMUSG00000000359   Transcript: ENSMUST00000000369
Sequence length 297
Comment pep:known chromosome:GRCm38:2:152626951:152635194:1 gene:ENSMUSG00000000359 transcript:ENSMUST00000000369 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLNTQQEAKTTLRRRASTPLPLSSRGHQPGRLCTAPSAPSQHPRLGQSVSLNPPVRKPS
PAQDGWSSESSDSEGSWEALYRVVLLGDPGVGKTSLASLFAEKQDRDPHEQLGGVYERTL
SVDGEDTTLVVMDTWEAEKLDESWCQESCLQAGSAYVIVYSIADRSSFESASELRIQLRR
THQANHVPIILVGNKADLARCREVSVEEGRACAVVFDCKFIETSATLQHNVTELFEGVVR
QLRLRRQDNAAPETPSPRRRASLGQRARRFLARLTARSARRRALKARSKSCHNLAVL
Download sequence
Identical sequences O35929
ENSMUSP00000000369 10090.ENSMUSP00000000369 NP_033073.1.92730 ENSMUSP00000000369 ENSMUSP00000000369

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]