SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000000811 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000000811
Domain Number 1 Region: 545-636
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 6.28e-41
Family Small-conductance potassium channel 0.00000385
Further Details:      
 
Domain Number 2 Region: 414-586
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 9.55e-27
Family Voltage-gated potassium channels 0.004
Further Details:      
 
Domain Number 3 Region: 31-104
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.000000654
Family beta-sandwich domain of Sec23/24 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000000811   Gene: ENSMUSG00000000794   Transcript: ENSMUST00000000811
Sequence length 732
Comment pep:known chromosome:GRCm38:3:89520164:89667761:1 gene:ENSMUSG00000000794 transcript:ENSMUST00000000811 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTSGHFHDSGVGDLDEDPKCPCPSSGDEQQQQQQPPPPPAPPAVPQQPPGPLLQPQPPQ
PQQQQSQQQQQQQSQQQQQQAPLHPLPQLAQLQSQLVHPGLLHSSPTAFRAPTSANSTAI
LHPSSRQGSQLNLNDHLLGHSPSSTATSGPGGGSRHRQASPLVHRRDSNPFTEIAMSSCK
YSGGVMKPLSRLSASRRNLIEAEPEGQPLQLFSPSNPPEIIISSREDNHAHQTLLHHPNA
THNHQHAGTTAGSTTFPKANKRKNQNIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMV
IETELSWGLYSKDSMFSLALKCLISLSTVILLGLIIAYHTREVQLFVIDNGADDWRIAMT
YERILYISLEMLVCAIHPIPGEYKFFWTARLAFSYTPSRAEADVDIILSIPMFLRLYLIA
RVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVR
VCERYHDQQDVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVV
AVVARKLELTKAEKHVHNFMMDTQLTKRIKNAAANVLRETWLIYKHTKLLKKIDHAKVRK
HQRKFLQAIHQLRGVKMEQRKLSDQANTLVDLSKMQNVMYDLITELNDRSEDLEKQIGSL
ESKLEHLTASFNSLPLLIADTLRQQQQQLLTAFVEARGISVAVGTSHAPPSDSPIGISST
SFPTPYTSSSSC
Download sequence
Identical sequences P58391
NP_536714.2.92730 10090.ENSMUSP00000000811 ENSMUSP00000000811 ENSMUSP00000000811 ENSMUSP00000000811

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]