SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000001127 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000001127
Domain Number 1 Region: 237-355
Classification Level Classification E-value
Superfamily ApaG-like 1.44e-36
Family ApaG-like 0.00037
Further Details:      
 
Domain Number 2 Region: 76-143,170-200
Classification Level Classification E-value
Superfamily YccV-like 0.0000000000157
Family YccV-like 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000001127   Gene: ENSMUSG00000001100   Transcript: ENSMUST00000001127
Sequence length 368
Comment pep:known chromosome:GRCm38:11:78512193:78522736:1 gene:ENSMUSG00000001100 transcript:ENSMUST00000001127 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGCVARRALAVGSRWWSRSLATTRGSRPLCAVGGAGGLPPVATATTRRHLSSRNRAEGK
VLETVGVFEVPKQNGKYETGQLFLHSVFGYRGVVLFPWQARLYDRDVASATPEKAENPAG
HGSKEVKGKTHTYYQVLIDARDCPHISQRSQTEAVTFLANHDDSRALYAIPGLDYVSHED
ILPYTSTDQVPIQHELFERFLLYDQTKAPPFVARETLRAWQEKNHPWLELSDVHRETTEN
IRVTVIPFYMGMREAQNSHVYWWRYCIRLENLDSDVVQLRERHWRIFSLSGTLETVRGRG
VVGREPVLSKEQPAFQYSSHVSLQASSGHMWGTFRFERPDGSHFDVRIPPFSLESNKDEK
TPPSGLHW
Download sequence
Identical sequences Q91VA6
NP_080665.1.92730 ENSMUSP00000001127 ENSMUSP00000001127 ENSMUSP00000001127 10090.ENSMUSP00000001127

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]