SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000001965 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000001965
Domain Number 1 Region: 521-706
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.28e-45
Family cAMP-binding domain 0.00035
Further Details:      
 
Domain Number 2 Region: 251-426,456-517
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.83e-44
Family Voltage-gated potassium channels 0.0025
Further Details:      
 
Domain Number 3 Region: 38-131
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.49e-19
Family Flavin-binding PAS domain 0.0000203
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000001965   Gene: ENSMUSG00000001901   Transcript: ENSMUST00000001965
Sequence length 950
Comment pep:known chromosome:GRCm38:11:106008173:106034549:1 gene:ENSMUSG00000001901 transcript:ENSMUST00000001965 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVRRGHVAPQNTYLDTIIRKFEGQSRKFLIANAQMENCAIIYCNDGFCELFGYSRVEVM
QRPCTCDFLTGPNTPSSAVSRLAQALLGAEECKVDILYYRKDASSFRCLVDVVPVKNEDG
AVIMFILNFEDLAQLLAKSSSRSLTQRLLSHSFLGSEGSHSRPSGQGPGPGRGKYGTVSQ
IPQFTLSFVEFNLEKHRSGSTTEIEIIAPHKVVERTQNVTEKVTQVLSLGADVLPEYKLQ
APRIHRGTILHYSPFKAVWDWLILLLVIYTAVFTPYSAAFLLSDQDDSQRGTCGYTCSPL
TVVDLIVDIMFVVDIVINFRTTYVNTNDEVVSHPRRIAVHYFKGWFLIDMVAAIPFDLLI
FRTGSDETTTLIGLLKTARLLRLVRVARKLDRYSEYGAAVLFLLMCTFALIAHWLACIWY
AIGNVERPYLEPKIGWLDSLGAQLGKHYNGSDPASGPSVQDKYVTALYFTFSSLTSVGFG
NVSPNTNSEKVFSICVMLIGSLMYASIFGNVSAIIQRLYSGTARYHTQMLRVKEFIRFHQ
IPNPLRQRLEEYFQHAWSYTNGIDMNAVLKGFPECLQADICLHLHRALLQHCPAFRGASK
GCLRALAVKFKTTHAPPGDTLVHLGDVLSTLYFISRGSIEILRDDVVVAILGKNDIFGEP
ASLHARPGKSSADVRALTYCDLHKIHRADLLEVLDMYPAFADTFWNKLEVTFNLRDADGG
LHSTPRQAPGNQDPQGFFLNDSQSGAAPSLSISDTSGLWPELLQQMPPSPPNPREKLDCW
PRELGFKLEQLQAQMNRLESRVSSDLSRILQLLQHPQGHPGYILGAPASSDLALFPETSV
TQSSESMLLVGHLPSAQTLSYGDLDKHIRMPRNFSPRIPHVAAAMDKSLVPSSEQEQPKG
LLSPLASPLCPLEVQGLGGPHFSSLPEHLSSVPKQLEFQRHGSDPGFTRS
Download sequence
Identical sequences Q32ME0
10090.ENSMUSP00000001965 ENSMUSP00000001965 NP_001032801.1.92730 ENSMUSP00000001965 ENSMUSP00000001965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]