SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000002029 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000002029
Domain Number 1 Region: 3-52
Classification Level Classification E-value
Superfamily LEM domain 0.0000000000000746
Family LEM domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000002029   Gene: ENSMUSG00000001964   Transcript: ENSMUST00000002029
Sequence length 259
Comment pep:known chromosome:GRCm38:X:74254687:74257887:1 gene:ENSMUSG00000001964 transcript:ENSMUST00000002029 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDYAVLSDTELAAVLRQYNIPHGPIVGSTRKLYEKKIFEYETQRRRLLPPNSSSSSFSY
QFSDLDSAAVDSDMYDLPKKEDALLYQSKDYNDDYYEESYLTTKTYGEPESVGMSKSFRQ
PGTSLVDADTFHHQVRDDIFSSLEEEGKDRERLIYGQDSAYQSIAHYRPISNVSRSSLGL
SYYPTSSTSSVSSSSSSPSSWLTRRAIRPEKQAPAAALGQDRQVPLWGQLLLFLVFAAFL
LFVYYSIQAEEGNPFWMDP
Download sequence
Identical sequences A2AM95 O08579
10090.ENSMUSP00000002029 ENSMUSP00000002029 ENSMUSP00000002029 NP_031953.1.92730 ENSMUSP00000002029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]