SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000002053 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000002053
Domain Number 1 Region: 306-403
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000000106
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.00078
Further Details:      
 
Domain Number 2 Region: 146-198
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000995
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.031
Further Details:      
 
Domain Number 3 Region: 45-97
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000034
Family HLH, helix-loop-helix DNA-binding domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000002053   Gene: ENSMUSG00000001988   Transcript: ENSMUST00000002053
Sequence length 594
Comment pep:known chromosome:GRCm38:7:16455721:16476780:-1 gene:ENSMUSG00000001988 transcript:ENSMUST00000002053 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATPYPRSGGRGEVKCGGGRGAGVPWDFLPGLMVKAPPGPCLQAQRKEKSRNAARWRRGK
ENLEFFELAKLLPLPGAISSQLDKASIVRLSVTYLRLRRFAALGAPPWGLRAVGPPAGLA
PGRRGPVALVSEVFEQHLGGHILQSLDGFVFALNQEGKFLYISETVSIYLGLSQVELTGS
SVFDYIHPGDHSEVLEQLGLRAASIGPPTPPSVSSSSSSSSSSLVDTPEIEASPTEASPA
FRAQERSFFVRMKSTLTKRGLNVKASGYKVIHVTGRLRARALGLVALGHTLPPAPLAELP
LHGHMIVFRLSLGLTILACESRVSDHMDMGPSELVGRSCYQFVHGQDATRIRQSHLDLLD
KGQVVTGYYRWLQRAGGFVWLQSVATVAGNGKSTGEHHVLWVSHVLSNAEGSQTPLDAFQ
LPAIVSQEEPSRPGPEPTEEEPPVDGKQAVPADQDKDKDPQARGKRIKVEASPKEARGSE
DSGEEELSDPPAPPRPEFTSVIRAGALKHDPVLPWGLTTPGDPSPALLHAGFLPPVVRGL
CTPGTIRYGPAELSLMYPHLHRLGAGPSLPEAFYPTLGLPYPGPTGTRVQRKGD
Download sequence
Identical sequences A2RSH6 P97459
ENSMUSP00000002053 ENSMUSP00000002053 NP_032744.1.92730 XP_017177510.1.92730 ENSMUSP00000002053 10090.ENSMUSP00000002053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]